ELF4 b 4 (44p4p44q4qpp    W   HHqHq Ptd8 8s 8s ,,Qtd/lib/ld-linux.so.2GNUI w2N1drG_ Oz]b2[#sDe>RAD^_Ja WQ* 6{8)}Zu =TIU f%xmP3idT1>sL8B' gb\bJ aA:9)E:=|4AG&S7jb@@r.FLcF(>h\Q`PSH9>J<0X:y{NzIFz wo !=/Y;w)rGh ?&;v( Wp6.%WHEEuq#fV/5'8!zBxQe2!$39dF%4D~aP QL8P$; mKER[gJp"o$Yw-yV'3h32+a*}y )!fx_-LG..OML0jsC5=7wbCvg,<(.]pl6:#lx,g`(r~X 0K0Wk{0Y <'jqmRC"]Sc7" ZIyT+&IlN=j[s [H1\Y0-|c u>n]51;?k8*<Dn"\%,} (ESK+dnJ'</qIOm^;>16= C,RyWB7J\-Gz^<2V~d>X?ef4YL[=i`*$ h#U@ uH /1oA7_g).kH^%Oo/rq:9,+v6$B$N@&m_]!Z7}2Z:nUn+LY5BhOSp]v`{\?D tx`~5ZaT $k m #tT6hV}k3.H~q#'`is? xFb- ugi0b-0_e,|eSr@}  q7;"  j2X_VP@jfCy ZPk]'4s\Z/UQF^AuN[U)CvezP {a|9o|sWclAKdHoQp 4)*< u|`78IpE9 t5RUXFG,#W^$4&*6-~.[M%k|VtBv*yM9D/pNK!)Y3!cXN46:OBG~ih SRMO,5&zRD eqE+?gT =>9KM  @wD%U%n't^HAB?JdTFfC3(1 VX1"j4K;n{(-+3C<v!xf?t&@ Al2ciol8w+5"iEclm";/a:{Q8 Gr#M*(M}I&t_u rBl ( Xu @ ^   <qDt$ _%"X `*? g4 @4O]_( wǤ ]nx "G`h  " ph1PxBp eP( ^0 x<^|  0 Y I   Mi Y yS  $ * / snIPA ` aM ) [ E mt ]O ] " Ա{ < ) hS 2lB e  "   s _  d  _ CB]. Tt L; P t \ zq   -  ]+ -x  $ 0d  H  v 2 + ? |G b; 8 . M48 qK ^t Zf   k   X &     l&  < -' &4 HD 6'#V #b \u 4  S )    d ,  0Sw ,/- fp  f!4 4 dF \84X *s $ t  0  4   p  %\  qj)Mg7#? [L b>|.u  Cץ _ U +Pv 4^ 6    W^t 3* ?p ;W. 0[#mH8d"b? R[ Ll  5 p  )/CP@ g z@ R( Lv emaj "BdI L ,ɉ L%"  / S? Q"=[Bp =|QB s۲ T  E1jt5 "+] H6D AWOo#~ hL.y" 8a% P S  UX $u 3.@  ;q  K^d s2W tn l  PL z@4 X b3  v  &065DD, kO^@ +|4gL\ ] 4cl <"`M@MW + ,Il ߄ v*CT4\; S YK`% Ux d! `v  -Y` %@>\3R+C\   oYva- Y)?qc[F ?P C\r r8z0<C 9 3V|| .6 e : Q*7Vd 2  h-Τ X'7@ Jx ,SpXt. h K* LsU[Q&5%{f p " N 7: L`, dX a 4qt ~ F ::; F bK'  "7   M]D"-(i?pX]m nb !vX 6j0u? k~ Qk 2gk0V# s , [0gE8U(o7Xe&.L$  4!#Z& { C{ 8 P (T h/.U8U fbt-  M~r@d  |  "'`- $]%`2o J]  Tf d t S~ )9 S P ;?F? n@ |.#6C&JLU" f Do<k|p X ~6: 2P #] G1 NY0U N0$P-CJe 0^z!!: $ Xv2?ub P|% Gus, ,pE!: D%Z +3 "Gh gu eq   HeZ|1(5܂ `kb) $ < h GC$ }K6 XJ 5X Jw f y      $ ?? } H  [ d  *H. !i!X +! --ٛ  I- [-|-- h-- -y-b*- - - -œ -U E .#  . #.w C6. sK.q^.0l.Б aA w.¡s.'r  . .L .q4.s 3.ڨ KSm..\ .S/q '/E/^[/d?m/^ Vw/\ / ]/: :/0$/ I/5^t!0 F90 *0(%  ;0U0 ea0q00h %0؟ l060 ;0h[ 80|0g0  1/\1e$*\-Y01h@#zX<1_1Rr1{0r1 17O'1Vd1-J1 - 1l 1c 2S282zO29e]h2_s 3t28 2ei2r\2 F2 27 2 2s3T 3R3 '3=  43fdM3f3" DE u31334 3 33 534  3SV93,u ^3 #4Ei &4 >4K4N]43 'l4c c|4$44 44@# 04 >4]D4 5~ 5P-W&5L* -5`.u>5 FO5 ]5 =l5+ "5, 55$5%R5"  5t j5 5860%$ )6 t76|D6a6p!w6nD6 N6|l6ڰ"6 6 63  6g ~67>x *757gH7 hV7 o7uV #~7V k7Iw7 ?7$7.W4 7\7] E`f7$  *%x  Z| 7 13*S 7z8 8.8_?8 (  &J82 Z8 -l8 "w8/ 8 8_8K X8= I8d M8 ]8TN8h~ 9 O.9 >9I9|O[9R!e9 X1y9 9 9` 9= 59tB <r9nR 9 9q z:' :cs':h`(: i5:< 9D:B O9@ ]:| m: P~:- I:<:x%>: h:: ;j  ;t#;`&;o6;WH;2s "S;A^mh;2r /u;$; ;i;@% ; E|;{n  ; ;@  <"   < 0Z 81<d:<D G<UbY<Kf<S>< a/<r5<^q<#y:<w h< <s;<X <=&/=u 42= H=^=H{ j=Ӵ t= = = E@j=p =Q= $=} =u= "=5=ZxB>2 )>S13 >>>X]8R>4 [>B )ko>2 > DZ >>Bd>v .>> n>?ͳ X?) X#?2A?: T?^ gh?+ q? 1?LaJ? X? {?} ?`? ?z#@ @|$ @=c .@i76B@h\@E}wg@ 1@ @ q@` H@t 3S@s1@_@@ @e#Ab Z^4. Au /%A 7A -JA 2[AoA A"A +mY kLA0 Ap| A" A A $A" B##Bŧ B6BQBd eB >yBF @Bn [B` UB-  B"ByB"B  BB] CBC ^)CӖ6C KCc, UCE E %E$ |~E g g F' F -Fq CFH, MF" ZFE /kF F{ !Fr RFU6F| RFե F iFS&F  GG!z /G  8G3 2IG4V $YG cG0UCoGd|GYjG G +Gz  &LG G G [bG$ H73Hk +*H #CH| THy jH5 Hr ?H HȇZ2H| H] H HdH + |H?H_8I6 RI^:"If 5IjHIg-`I mI# vI| IGID IjdUI IL ^I%AI 'J~ (J ? 69Jvu OJL S aJ$sJJ( g0 =T>Je ;J( J JNJy K, K< ;Kt JK`K| mK$yK^$Kn uK|K K KС KX, K\ <KB }:KUo7L$L@!Lpf4L HLs'ZLKfkL ~Lo LL{"ZL} 9L\Ly `L L#ML_=M_*(Mx 0M :M;$GMR` .TM$`MkM |MMMMP MO ?MX  M$M"M. ='M MuNQNN0,NV /=NQKN#SN$aN&  kN N N NN AND No)N * ,N<MO|  Oe/O%>O 5RO"bO iOO zO[ :O OGe >OfbOE:O &O:O܊ O PB P ,Py IAPC +WPf^ +^P|P{} P -j  P  3Pc P m' P"P P QwpQ d76IӬ&Q\* -Q[ )CQ_< QQd!fQ0 tQ Q] %QQA {Q߅ p#7 Q QlqQMRrZ<RWB %,R~e/FRˇ'VR$fR. +vRg vRR R LRTHR# $R, R6R  F|1Rgp;R C ! Sx @e !ST(S1 6St @S0d OSn _S$nSK_zSI Sv-S1S]S _S `Sr 3SulTq TnA;TKTLXT_=mTETW T T V T]zT KT6T_ T qU)UҰ P"U4~ 4.U' LU$ Q\U7[eUU U KUzUH& :0UYiUh KUVg:$V% 60V XAV} {MV  [ d]V8 nVz  Vb'Vl V |V`) (V  [VA _V` dV 0 W yR"W4 K@+8UJWWW\ bWXV pWjW O %}W W)sW;i +WNWn5 W̐ WNW%W+_ VXX,s 3-XEX RXws! ^XD IjX"Xq Xay QX[>XPXo XVJXk Xd;YNjYL  +Y &#ZkZ&  Z3+[c [W&[ 8[H E[LZ&T[zZ $`[m[bx[  [ [t [pC![-[[L [ \- kQ\Г L\[7\ @\t [\ h\ - 0o\P\ N\0 \\ [F\%  \\G #\ ] "] /]Y# ?]h!U]p s] ]]` l]]]2e&] ] JL ] 3^ 5^Pq@O3^t 8"H^a^ E r^ZW@%^\^u <^G<^@ ^0 ^(.  ^H ^( _, _%_#3_iv =E_ Q_[ xa_ r_ {_ >_T6_ _2_0 _n_ ~_jG_ ` (`6 [7`FFK`d^`o IS 0t` {`l!`h2` `@oB iE\x )C`, ` ``Ug  a\Ra u&a  Mx[ 8aEp Da "Sa 7fa ~a$ax a5]a uaWal|3as2aO~ Yb"Y(bT3b$?b Jb] 5^bm vb! babp+ybanb lb #c^LccC!c, 7c Fc ^c kc tc mc ! Pc _c+t 3c3 Occ c cPb Rc@ d 'd f+ 8If& ]fGo  ff $+| uf f~7 4 Fft 393ff8 fH fNf<  g$g+gj Fg Vg bg8 ={gM #g gt [ g-IJ:g AgX g .g$ h$h&h  dD 3hFFhhch.BrhThl/h`" 8h@  h hRhh4 ~ hR 2io #il)iN3i$FiYiFzi@Z :i $i< ipiFRi^1i@Pi` j Tj2T +j%Nj"ejU N}j {jjz Lj j j8Tj$ kk &kh _;kB Lke 5_k tk<9k&?Bk k%kRTk@ 4k(] k.kl /^ zl'l[ P5l_ U@l|  Nl~F^l, HglO ls l:2llm +lls<l= lcTmH%'mў 7mdnOmgm tmܟ mD m m@O(m mM7m9 ]mar n, n" nQTr'/n$>L;ns 3Mn^ng 2tnp}n dn$nAns@An%a|nS6n, obio| )%o:oE -Po iQWo co^noJ R|o"ooћ o oo oo,o ppR# $p>S3p 0=p %Op< z \pl EhpbUK pp2e0p bMnbM%9bMM;pbM9Y   W ,0T p   <HL h7 O`OOOĴOlibtermcap.so.2tgetnum_DYNAMICtgototgetflagBCtputsPCtgetent_GLOBAL_OFFSET_TABLE_UP_Jv_RegisterClassestgetstr__gmon_start__libdl.so.2dlerrordlclosedlsymdlopenlibc.so.6putcharsetgrentstrcpysetrlimit64unsetenvregexecwaitpidioctlgetserventgetgidsysconfstdoutgetdtablesizesetserventreaddir64__strtoull_internalsigemptysetfdopengeteuid__mbrlenmemmovepathconfwcslengetegid__strtol_internalgetpidqsortfgets__strtoll_internalmemcpysetvbufreadlinkdup2mbrtowcgetuidiswlowerisattyconfstrendpwentsiglongjmpvsnprintfwcsncmpsocketselect__strtoul_internalfflushputenvsigaddsetstrncasecmpsetpgidfreeaddrinfowcscollalarm__sigsetjmpstrnlenmblenstrrchr__ctype_tolower_loc__strtold_internalgai_strerrorgetrlimit64__ctype_get_mb_cur_maxsetpwentstrcatdcgettextchdirendgrentmemchrumaskferrorstrstrsetgidpread64iswctypestrcollstrncmpwcsrtombsstrncpyunlinkgetrusagestrcasecmpwcwidthtowupperforkgetgrentsigactionwcschrkillpggroup_membersbrk__xstat64regcompgettimeofdaylocaltimememsetclearerrgetppidtcgetattropendirgetgroupsttynamegetpwuidgetcwdstrsignalgetpwnamgethostnamesprintffclosesetlocalegetpeernamestderr__lxstat64fputc__ctype_b_lociswuppergetaddrinfostrftimefwritetcgetpgrp__errno_locationwcsduptowlowerbindtextdomainsigdelsetwcscmp_IO_putcfileno__ctype_toupper_locendservent_IO_stdin_usedgetpwentwctob__libc_start_mainlseek64regfreefputsclosedirfcntltzsetsetuidtcsetattrwcrtomb__fxstat64mbtowcvfprintfstrpbrktcsetpgrptcflowsigprocmaskmbsinitfopen64__environ_edata__bss_startrl_kill_lineread_docarray_expand_indexall_array_variablesdebugging_login_shell_rl_enable_metarl_funmap_namesbind_array_variablejust_one_command_rl_free_history_entrymake_select_commandxmallocsh_getoptcurrent_jobsort_variablesmake_word_flagsrl_deprep_term_functionrl_restore_statextrace_print_assignmentrl_display_promptstream_listxpg_echoupdate_export_env_inplacerl_ignore_some_completions_functionmake_default_mailpathdstackrl_line_buffercheck_identifiershift_builtinterminal_pgrpexit_immediately_on_errormaybe_save_shell_historylocaleexpandfg_builtindirs_builtinstrip_trailing_ifs_whitespace_rl_complete_mark_symlink_dirsxfreecompspec_disposeallow_null_glob_expansionlogout_docsetup_glob_ignorerl_vi_checkshopt_builtin_rl_erase_at_end_of_lineextended_globttsetattrbrace_expand_rl_strip_promptcompgen_builtinrl_vi_yank_torl_vi_completerl_dingtt_setnoechobegin_unwind_framerl_tty_unset_default_bindings_rl_get_char_lenrl_kill_texthistory_comment_charglob_vectorget_dollar_var_valuerl_macro_dumperbuiltin_docset_bash_input_fdstrlist_appendoriginal_pgrprl_instreammake_builtin_argvrl_read_init_fileremember_mail_datesexpand_words_shellexp_rl_history_saved_pointfind_flagarray_to_word_listinitialize_shell_variablesrl_completer_quote_characterszcatfdrl_crlfsh_optargrl_directory_rewrite_hookrl_filename_completion_functionstatic_shell_builtinsfind_string_in_alistsource_doccurrent_command_subst_pidload_historysv_strict_posixcopy_function_defrl_vi_matchset_signal_ignoredpromptvars_rl_with_macro_input_rl_output_meta_charsinternal_strmatchrl_rubout_or_deletesubshell_envpshell_version_stringparser_errorlist_stringneed_here_docset_current_prompt_levelfilter_stringlistsignal_is_ignoredcopy_function_def_contentsrunning_under_emacsrl_arg_signrl_key_sequence_lengthrl_filename_quoting_functionshell_function_defsall_visible_functions_rl_dispatch_subseqhistory_max_entrieszreadcxtrace_print_cond_termrl_marktype_builtinrl_untranslate_keyseqprint_cond_commandhash_builtinexecute_prompt_commandsource_file_rl_vi_set_lastttnocanonsearch_for_commandlegal_identifierhistory_set_postt_setonecharwdcacheextract_colon_unitsh_invalidsiguser_command_matches_rl_restore_tty_signalsxdupmbstowcshistory_lines_this_sessionvi_insertion_keymapsh_unset_nodelay_mode_rl_vi_last_commandall_shell_variablesit_groupsrl_end_undo_grouprl_call_last_kbd_macrorl_vi_replacerl_set_keymap_from_edit_modebind_variable_valuede_backslashlast_command_subst_pidvi_movement_keymapreturn_catchset_locale_varsccs_versionsh_restrictedrl_completer_word_break_characterswith_input_from_buffered_streamrl_filename_dequoting_functionansic_shouldquotearith_docarray_to_stringfind_user_commandsv_localebash_history_disablehistory_expansionarray_dispose_elementset_return_traprl_modifyingrl_discard_argumentbreakingcurrent_command_numberrl_vi_ewordrl_reverse_search_historyhistory_expansion_inhibitedbg_builtinarray_to_argvmaybe_execute_fileexpand_string_to_stringrl_dispatchingbash_directory_completion_matchessave_token_statepre_process_linewrite_historyprint_var_listset_job_control_rl_unget_charrl_redisplayset_ppidno_line_editingsh_badjobrl_show_char_rl_digit_valuerl_executing_macrodiscard_unwind_frameprogcomp_insertcolon_builtincurrent_fds_to_closehistory_expandstop_making_children_rl_terminal_can_insertrl_already_promptedit_jobsinitialize_itemlistrl_unix_word_ruboutcommand_errstrarray_subrangeshell_pgrpnohup_all_jobsrl_bind_key_if_unbound_in_mapcurrent_prompt_stringarray_quotezreadintrrl_vi_start_insertingrl_clear_signalsposix_initializerl_revert_linerl_reset_after_signalsh_backslash_quote_for_double_quoteshash_walksv_ifscompspec_createcopy_wordrl_numeric_argrl_dump_variablesrestore_parser_statehup_on_exitmax_input_historyrestore_pipelineprog_completeskill_current_pipeline_rl_overwrite_ruboutfull_pathnameclose_buffered_streamadd_history_timeinterrupt_immediatelybuffered_getcharbash_logoutrl_set_retained_killsset_pwderr_badarraysub_rl_make_prompt_for_searchrl_bind_key_in_mapstrvec_flushaddtimevalsave_pipelinedescribe_pidperform_hostname_completionextract_arithmetic_substread_builtinrl_deletereadline_echoing_pwcsmatchxtrace_print_select_command_headrl_insert_comment_rl_init_terminal_iothis_shell_builtinfc_docmake_absoluteexit_shellmaybe_set_sigchld_trap_rl_update_finalprog_completion_enabledhistory_reeditinghistory_set_history_staterl_vi_first_printdeclare_doclcurrentrl_line_buffer_len_rl_vis_botlinthis_command_namerl_free_undo_listrl_insert_closeget_word_from_stringrl_overwrite_modeexpanding_redir_fp_hwinteractive_commentsdefault_tty_job_signalscontinuingget_random_numberxtrace_print_for_command_headrl_menu_completenetopenprogcomp_searchrl_display_fixedmake_subshell_commandhistory_total_bytesexit_builtinparse_and_executeabsolute_program_rl_undo_group_levelit_variablespop_scopeinternal_wstrmatchifs_varrl_directory_completion_hookdump_translatable_stringsget_variable_valuerun_unwind_protectsstring_rest_of_argsread_but_dont_executerl_vi_columnrl_executing_keymapunset_docrl_yankget_job_by_namemark_modified_varsrl_readline_staterl_explicit_argrl_completion_entry_functionrl_catch_signalsunclosed_pairbreak_docxtrace_print_arith_cmdtrap_list_rl_possible_meta_prefixesrl_filename_completion_desiredsubshell_environment_rl_pop_executing_macro_rl_dispatchmake_variable_valuecaller_docreadline_internal_setupttgetattrtimeval_to_secsrl_vi_delete_torl_ruboutrl_noninc_forward_search_againrl_delete_horizontal_spacerl_undo_listignore_signal_rl_adjust_pointdescribe_commandexpand_wordsreset_mail_filesrl_history_search_backwardrl_donerestart_job_controlword_splitrl_variable_bindpopd_docphash_removesubshell_levelfind_index_in_alistlist_lengthsourcelevelwith_input_from_streamifs_firstcrl_insert_textrl_refresh_linerl_vi_goto_markcommand_errorhistory_get_history_statemake_local_array_variable_rl_init_line_statetilde_expansion_preexpansion_hookit_filestype_docyyparseinitialize_job_controlcontinue_builtinset_signalrl_vi_eof_maybetest_eaccesspwd_docinit_yy_ioget_current_prompt_levellogout_builtinsh_setlinebufparse_symbolic_mode_rl_convert_meta_chars_to_asciish_nojobswhere_historysh_syntaxtabassign_array_elementmake_local_variable_rl_kill_kbd_macrofind_function_defclean_simple_commandtrap_docvalid_array_reference_rl_is_mbchar_matcheddispose_redirectsunbind_function_defskipsubscriptremember_argsarray_needs_makingecho_input_at_readbrace_expansionreturn_EOF_rl_term_gotorl_on_new_line_with_promptpipeline_pgrpuitosemacs_standard_keymapmaybe_add_historymake_function_defcurrent_user_rl_input_queuedindirection_level_stringit_shoptsrl_vi_append_modereadline_top_level_rl_savestringstrlist_from_word_listset_or_show_attributessv_histignoremaybe_make_restrictedexec_doctermination_unwind_protectpush_contexthistory_getprivileged_moderl_vi_prev_wordget_hostname_listrl_restore_promptcolon_doctimes_builtinexecutable_or_directoryrl_maybe_replace_linerl_unix_filename_ruboutreadonly_builtinstrip_trailing_rl_compare_charsrl_display_match_listwait_for_single_pidthe_printed_command_except_trapnum_shell_builtinstime_to_check_mail__libc_csu_finiset_dollar_vars_unchangedget_history_eventrl_set_signalsprint_simple_commanddot_doc_rl_term_icstdin_redirectsrl_maybe_save_linemake_arith_for_commandrl_noninc_forward_searchtilde_expansion_failure_hookglob_error_returnmailstatexit_docmaybe_append_historylist_optargsh_double_quotebash_history_reinitpop_var_contextsetup_async_signalssh_mktmpfpstrlist_sortshow_var_attributeshash_bucketrl_forced_update_displayrl_unbind_keyrl_clear_pending_input_rl_completion_case_foldunlink_fifo_listrl_forward_search_history_rl_complete_show_unmodifiedstrlist_printstring_list_dollar_atrl_bind_key_if_unboundexport_docbash_brace_completionsv_globignoreit_servicessource_builtinrl_noninc_reverse_search_againmake_pattern_listmake_bare_wordget_group_listrl_completion_suppress_quoteread_historydisown_docterminate_stopped_jobsrl_library_versioninitialize_flagsthe_current_working_directoryrl_quoted_insertrl_copy_textbuiltin_usagerl_vi_domoverl_alphabetic_rl_term_autowrapend_job_controlrl_vi_yank_argifs_cmapwithout_job_controlreset_signal_handlersrl_gnu_readline_prl_attempted_completion_functioncurrent_readline_promptget_job_by_pidmake_redirectionfind_special_builtincopy_redirectstime_docfile_errorhistory_arg_extractrl_vi_bWordbash_add_historyskip_to_delimget_alias_valueit_runningsh_get_env_valuesh_notbuiltinrl_getc_functionrestricted_shellparse_and_execute_cleanupit_signalssh_needargalphabet_set_rl_vi_done_insertingfunction_trace_modeexpand_word_leave_quotedhistory_word_delimiterssh_syntabsizshell_start_timefail_glob_expansionbash_dequote_textstrlist_copyumask_doclocaletransrl_readline_nameset_dollar_vars_changedhistory_no_expand_charsrl_tty_statusvariable_contexttilde_initializerl_unbind_function_in_maprl_unbind_key_in_maparray_create_elementrl_transpose_charsevalexphistory_lines_in_fileparse_commandgive_terminal_totilde_expand_wordvar_lookupexecuting_line_numbersh_exittrap_builtinhelp_builtinsignal_names_rl_current_display_linekill_docsh_invalididdot_found_in_searchset_default_locale_varsrl_beginning_of_historycopy_commandstrlist_disposeindirection_levelbash_re_editlegal_number_rl_complete_mark_directoriesmake_here_documentrl_username_completion_function_rl_set_insert_modepolite_directory_format_rl_vi_textmod_commandsh_set_lines_and_columnsparse_string_to_word_listdo_assignment_no_expandcheck_window_sizethe_printed_command_rl_term_clreoltt_setnocanonrl_forwardlast_history_linehistory_quotes_inhibit_expansionbind_docsv_histsizeno_symbolic_linksbinary_testmake_group_commandrl_digit_argumentsv_tzset_shelloptsrl_backward_wordget_minus_o_optscase_docsv_pathrltty_set_default_bindingsrl_vi_back_to_indentthrow_to_top_levelsubshell_argvit_enabledassign_array_var_from_word_listsh_mktmpnamestartup_staterl_last_funcarray_disposesh_invalidoptfc_builtincdspellingbind_builtinmove_to_high_fd_rl_qsort_string_comparerl_completion_suppress_appendfd_to_buffered_streammake_cond_commandttonechartilde_additional_prefixesunbound_vars_is_errorrl_expand_promptinitialize_aliasesrl_get_keymap_by_name_rl_allow_pathname_alphabetic_charswait_builtin_rl_disable_tty_signalstest_bracket_dochostname_list_initializedrl_completeclose_pgrp_pipearray_to_assignpop_contextsource_searches_cwd_rl_control_keypaduinttostrsv_ignoreeofbash_servicename_completion_function_rl_find_completion_wordexpand_string_unsplitrun_unwind_framehash_stringrl_completion_display_matches_hookunfreeze_jobs_listall_visible_variablesglobal_commandtrap_to_sighandlermake_until_commandexpand_word_unsplitxmbsrtowcsrl_blink_matching_parenunset_sigwinch_handlershell_is_restrictedhistory_write_timestampsfind_variable_internalmake_bare_simple_commandsh_notfoundrl_filename_quoting_desiredmake_simple_commandsignal_is_trappedrl_resize_terminaldebugging_moderl_char_searchsh_badopt_rl_last_c_posarray_flushsame_filerl_terminal_namehistory_listkill_all_local_variableshistory_delimiting_charsfg_percent_docprint_var_valuethis_shell_functionpatch_levelrl_arrow_keysdelete_all_jobs_rl_next_macro_keyit_bindingsbase_pathnamestrlist_resizerl_bind_keyseq_if_unboundsh_canonpathecho_command_at_executedispose_wordalias_expand_wordrl_stop_outputbuiltin_builtin_rl_print_completions_horizontallybash_readline_initializedpipefail_optselect_docrl_undo_commandignore_tty_job_signalscommand_substitutestrvec_strcmpreport_errorbg_docinternal_warningrl_vi_overstrikerl_save_staterl_vi_set_markrl_re_read_init_filetrue_docdollar_dollar_pidrl_completion_found_quotecopy_word_listuntil_docrl_backward_kill_wordinteractive_shellcommand_execution_stringset_pipestatus_from_exitrl_macro_bindshell_execverl_filename_quote_charactersbash_input_fd_changedreset_mail_timerstrsubsetup_ignore_patternsword_list_remove_quoted_nullsprevious_jobget_array_valueset_itemlist_dirtypwd_builtin_rl_saved_line_for_historyget_numeric_argps1_promptunwind_protect_memrl_stuff_charthe_printed_command_sizeprogcomp_flushprogcomp_removeexecute_shell_functionsubstring_rl_term_ipsys_errorsignal_is_specialttsaverl_pending_inputerr_unboundvarstring_quote_removalyynerrssv_history_controlmake_for_commandreturn_docdo_redirections_rl_vi_reset_lastpush_scopedisown_builtinmalloc_trace_at_exitarray_patsubhistory_search_poslocal_builtindifftimevalrl_backward_bytecheck_binary_filestrvec_from_word_listexpand_string_unsplit_to_stringhashing_enabledarray_keysreset_shell_flagsnohup_jobfind_token_in_alistother_token_alistrl_event_hookeof_encounteredrl_copy_keymaprl_messageprogrammable_completions_rl_mark_modified_lines_rl_strindex_rl_find_prev_mbcharlist_running_jobsexec_builtinprimary_prompt_rl_char_search_internalrl_yank_nth_arghistory_get_timeshopt_setoptwant_pending_commandbash_groupname_completion_function_rl_set_cursorlast_shell_builtinrl_set_paren_blink_timeoutcd_builtin_rl_isearch_terminatorsSBnew_var_contextrun_pending_trapssh_mktmpfdsync_buffered_stream_rl_to_upperrl_completion_mark_symlink_dirscurrent_host_namequote_globbing_charstest_docremove_historyfalse_builtinrl_redisplay_functionbrace_arg_separatorgrouping_braces_dochistory_tokenizekill_pidrl_outstreamabsolute_pathnamearray_insertterminate_current_pipelinerl_dump_macroshistory_numberreader_loopput_command_name_into_envsh_backslash_quoterl_end_of_lineexpand_words_no_vars_rl_free_match_listfind_variable_rl_enable_meta_keyrl_universal_argument_rl_complete_show_allrl_yank_poprl_vi_putjobs_m_flaghistory_searchstrvec_to_word_listfmtumaxset_debug_trapshopt_docrl_forward_bytefind_functionspnamebashline_reinitializewait_forrl_set_keyerr_readonlyadd_or_supercede_exported_varungetc_with_restartpop_argsrl_reset_line_staterl_variable_dumperrl_forward_wordassign_in_envmake_while_commandstrlist_mergestring_list_internalrl_history_search_forwardlist_rest_of_argsrl_maybe_unsave_linehistory_docextract_array_assignment_list_rl_add_macro_charrl_vi_fetch_historyeval_docrl_vi_change_charclose_buffered_fdrl_discard_keymap_rl_read_mbstringstrvec_removereturn_catch_valueeof_encountered_limitrestore_token_statecommand_string_indexrl_endbreak_builtinset_sigchld_handlerquote_string_for_globbingunary_testrl_unbind_command_in_mapansic_quotetest_builtindirs_docsh_readonlysigint_sighandlerwait_for_jobinitialize_readline_rl_get_screen_sizestream_on_stackrl_vi_change_casestrlist_flushlist_minus_o_optsread_history_rangerl_vi_append_eolmerge_temporary_envreadline_internal_charhist_last_line_addedfind_shell_builtin_rl_enable_paren_matchingstrlist_to_word_listif_docpushd_builtinprintf_docinterrupt_statearray_unshift_elementrl_vi_search_againenable_hostname_completion_rl_set_mark_at_posdelete_all_contextsrl_vi_subst_rl_abort_internalttcbreakcontinue_docglobal_error_listnamed_function_stringcheck_add_historyrl_set_marktempenv_assign_errorprint_var_functionrl_vi_searcharray_removeminus_o_option_valuexstrmatchlist_all_jobsset_pipestatus_arraygather_here_documents_rl_to_lowercdable_varsassign_array_from_stringphash_flushprint_rlimtype_rl_lowercase_p_rl_set_screen_sizejob_slotslist_optoptbash_tilde_expandzsyncfdrl_replace_linemk_msgstrshell_namestrlist_prefix_suffixrl_completion_query_items_rl_pure_alphabeticsh_optindrl_completion_typehistory_subst_char_rl_term_dcunalias_builtinwhile_docrl_push_macro_inputrl_kill_word_rl_rubout_charfind_reserved_word_rl_free_saved_history_lineexecutingset_if_notnumber_of_argssh_validfdget_tty_state_rl_bell_preferencexreallocphash_searchget_shopt_optionsrl_completion_modegetifshistory_offsetulimit_docprint_timevalpush_dollar_varsrl_start_kbd_macroreplace_history_entrylocal_docfunction_doc_rl_clear_screenrl_erase_empty_lineexecutable_filerl_make_keymapmake_funcname_visiblerl_named_function_rl_overwrite_charhistory_truncate_filerun_exit_traprl_read_keyconvert_var_to_arrayrl_byte_orientedset_langrl_vi_insert_begprogcomp_createsh_opterrfile_iswdirarray_createrun_debug_traprl_add_funmap_entryulimit_builtinrl_copy_forward_wordemacs_ctlx_keymapsuspend_continuerl_reset_terminal_rl_screenheightdispose_fd_bitmaprl_bind_keyseqrl_noninc_reverse_searchrl_yank_last_argget_working_directoryhistory_search_prefixno_argsansiexpandshow_shell_versionrl_insert_moderl_vi_fWordit_setoptsreturn_catch_flaggetopts_dochash_sizemake_command__libc_csu_initfd_is_bash_inputset_minus_o_optionoutput_requirementunquoted_glob_pattern_pis_directorywait_docstrvec_lenset_var_read_onlyrl_basic_word_break_charactersmake_arith_commandrl_invoking_keyseqs_in_mapreturn_builtindequote_stringrl_restart_outputrl_do_lowercase_version_rl_clear_to_eolrl_backward_kill_line_rl_insert_typeinrl_binding_keymapsubst_assign_varlistrl_pre_input_hookrl_vi_tilde_expandplace_keywords_in_envbash_getcwd_errstrstring_to_rlimtyperl_copy_region_to_killdisallow_filename_globbingrl_ignore_completion_duplicatesrl_upcase_wordmaybe_make_export_envget_job_spec_rl_term_upmake_word_rl_backspacestart_jobnoclobberdefault_buffered_inputrl_tab_inserttypeset_doczreadrl_save_promptxtrace_print_word_list_rl_term_crsubshell_top_levelset_signal_handlerreset_shell_optionslist_stopped_jobsinitialize_trapsrl_function_dumper_rl_read_mbcharsub_append_stringarray_shift_elementrl_add_undounset_bash_inputrl_dump_functionsforced_interactivelist_opttypecommand_connectopen_buffered_streamxstrchrsh_optoptphash_creatett_setcbreak_rl_term_eimake_childgnu_error_formatdecode_signal_rl_match_hidden_filesget_locale_var_getenv_rl_term_pcno_empty_command_completionrl_backward_charit_disabledtest_binopset_error_trapexpand_prompt_stringprogcomp_disposedo_assignmentloptend_rl_in_streamshift_docset_dirstack_elementrl_execute_nextdeclare_builtinrl_complete_with_tilde_expansionrl_vi_arg_digitit_keywordsmake_command_stringhash_docexpand_stringstrvec_createwait_for_background_pidshistory_lengthrl_begin_undo_groupcurrent_builtinxbcopycomplete_builtinrl_forward_char_rl_vi_initialize_linetimeval_to_cpusv_optindsetifsrl_catch_sigwinchdispose_function_def_contentsrl_getcread_secondary_linepush_streamredirection_expandrl_unix_line_discard_rl_output_some_charsttattrrl_completion_word_break_hookdisplay_signal_listrl_make_bare_keymapwlcachestrcreplaceno_invisible_varscheck_hashed_filenamesrl_completion_matchesit_directoriesremove_aliasbuffered_ungetcharfg_docrl_bind_keyseq_in_map_rl_move_vertwait_signal_receivedbuild_version_rl_keymaprl_set_keyboard_input_timeoutrl_character_len_rl_pushed_input_available_rl_any_typeinget_current_user_infoinitialize_bash_inputrun_return_trapsh_getopt_restore_stateclear_unwind_protect_listdispose_command_rl_term_clrpagbuiltin_addresssh_makepathrl_capitalize_wordprotected_modefile_isdirarith_for_docrl_set_keymapbind_functionrl_backwardinitialize_signalsrl_readline_versionget_exitstatstart_pipelineunset_builtinsh_erangecaller_builtincommand_builtin_rl_out_streamdelete_all_variableshistory_expansion_chartest_unopextract_process_substread_commandrl_get_termcapduplicate_buffered_streamno_optionsconnect_async_listbuiltin_errorinitialize_terminating_signalsunbind_variablealias_expandfree_buffered_streamarray_assign_listdecode_prompt_stringlast_made_pidrl_newlineset_tty_staterl_vi_bracktypedisable_priv_modett_seteightbitreset_terminating_signalsreset_parserrl_vi_end_wordstrvec_sort_rl_output_character_function_rl_screencharsmbstrlenhistory_search_delimiter_charsget_dirstack_from_stringrl_list_funmap_namesarray_rshiftsuspend_docfind_or_make_array_variable_rl_clean_up_for_exitsetup_history_ignorebind_int_variablerl_vi_fwordrl_end_kbd_macrostrvec_copyrl_editing_modesecondary_promptrl_copy_backward_wordarray_from_word_listrl_translate_keyseqsh_un_double_quotejobs_docfile_statuspush_var_contextrl_bind_key_rl_fix_last_undo_of_typelast_asynchronous_pidasynchronous_notification_rl_meta_flagtest_commandit_aliasesprogcomp_sizesv_histcharsrl_generic_bindreap_dead_jobs_rl_erase_entire_linechange_flagcompletions_to_stringlistit_stoppedwhich_set_flagsarray_shiftttnoecho_rl_suppress_redisplaysh_neednumargarray_keys_to_word_listecho_builtinunbind_funcrl_vi_eWordforce_append_history_rl_digit_pread_octalbash_history_enablewith_input_from_stdinrl_get_next_history_rl_doing_an_undorl_vi_redomake_cond_nodeset_sigint_handlerrl_backward_char_searchunstifle_historyerror_trace_modesuspend_builtinrl_delete_or_show_completions_rl_screenwidthrl_parse_and_bindset_login_shellstrlist_walkrun_trap_cleanupdispose_saved_dollar_varsstring_list_dollar_starjump_to_top_levelchar_is_quotedreadline_internal_teardownttrestoreliteral_historycurrent_command_line_count_rl_find_next_mbcharrl_special_prefixescount_all_jobsdispose_wordshist_verifyfind_tempenv_variableshell_glob_filenamereadonly_docread_from_stdinrl_downcase_wordnew_fd_bitmapemacs_meta_keymapit_arrayvarsrun_error_trapgetmaxchildrpm_requiresmake_case_commandrl_vi_undorl_vi_bword_rl_input_availablehash_disposeprint_commandall_exported_variablestilde_additional_suffixesrl_initializeshopt_listopteval_builtinmaybe_call_trap_handlerfmtulongexec_redirection_undo_listkill_builtincd_docarray_variable_partset_var_attributeshell_ttylocal_exported_variablespush_argstimes_docstupidly_hack_special_variablescurrent_historycurrent_readline_linerl_vi_change_torl_vi_deletegetopts_builtintrap_saved_exit_value_rl_possible_control_prefixesrl_prep_terminaladd_aliassh_regmatchdump_po_stringsexecute_commandremove_unwind_protect_rl_horizontal_scroll_modeparse_shelloptscompgen_docrl_add_defunxtrace_print_case_command_headnoglob_dot_filenamesexecute_command_internalglobal_variablesremove_backslashesget_group_arraystrlist_removearray_walklet_builtinrl_completion_append_characterunalias_docremember_on_historylet_doccommand_docinitialize_job_signalswait_intr_bufrl_kill_full_lineEOF_Reachedrl_vi_next_word_rl_set_the_lineoptflagsenable_builtinfind_aliascomplete_docwith_input_from_stringextended_quoteps2_promptinitialize_shell_optionsclose_fd_bitmaprl_vi_overstrike_deleterl_invoking_keyseqsrl_on_new_lineclear_hostname_listadd_unwind_protectrl_extend_line_bufferzwriterunning_trapstdin_redirthe_current_maintaineryy_input_namefalse_docit_hostnamesrl_attempted_completion_over_rl_redisplay_after_sigwinchcmd_initset_default_localerl_vi_char_searchsh_realpathtop_level_maskrl_transpose_wordsrl_get_previous_historyrl_num_chars_to_readhistory_builtinlist_one_jobprint_array_assignmentrun_interrupt_trapprint_arith_commandmakunboundrl_do_undoget_string_valueall_variables_matching_prefix_rl_term_imit_exportsrl_vi_movement_moderl_cleanup_after_signalvariable_help_docarray_variable_nameget_name_for_errorsave_bash_inputrl_bind_keyseq_if_unbound_in_maprl_get_keymap_name_from_edit_modemake_word_listmake_if_commandrl_prep_term_functionrl_beg_of_linerl_possible_completionswordexp_onlyansicstrsh_single_quotepushd_docrl_set_promptsh_invalidnumclean_itemlistyylval_rl_parsing_conditionalized_outfind_path_fileisnetconnalready_making_childrenrl_insert_completionsrl_complete_internalifs_valuerestore_original_signalssv_terminalumask_builtin_rl_push_executing_macrorl_get_keymapsv_mailprogcomp_walk_rl_eof_charsubshell_argcgen_compspec_completionsit_userscleanup_the_pipelineprompt_string_pointerrl_basic_quote_charactersdelete_job_rl_page_completionsrl_function_of_keyseqsave_parser_statestrlist_createprint_shift_errorsv_hostfilerl_kill_regionfunmap_program_specific_entry_startrl_vi_editing_moderl_tty_set_default_bindingsset_buffered_streamrl_exchange_point_and_markenable_docreset_shopt_optionsrl_abortsv_histtimefmtcurrent_readline_line_indexalias_expand_allsh_badpidfree_pushed_string_inputdist_versionget_directory_stackprint_func_listbash_badsub_errmsg_rl_term_ICdispose_used_env_varsshould_ignore_glob_matchesposixly_correctunbind_argsrl_visible_prompt_lengthexport_builtinit_functionspushed_string_listfatal_error_rl_replace_text_rl_last_command_was_killinitialize_shell_builtins_rl_comment_beginrl_pointsh_get_home_dirlist_reversedelete_all_aliasesassign_array_var_from_stringinternal_errorall_shell_functionscond_expand_wordconditional_dochistory_is_stifledredirection_errorpat_substprintf_builtinbind_keyseq_to_unix_commandrl_tilde_expandlast_command_exit_valuesv_opterr_rl_term_backspaceadjust_shell_levelcommand_word_completion_functiongetmaxgroupsrl_insertrl_promptlast_command_exit_signalrestore_default_signalmake_word_from_tokenposix_readline_initializeforce_fignorerl_initialize_funmapcompspec_copyhistory_inhibit_expansion_functionno_exit_on_failed_execsh_contains_shell_metasrl_deprep_terminalcurrent_command_first_line_savedset_working_directory__data_startword_token_alisthangup_all_jobsrl_inhibit_completion_rl_last_v_posit_builtinsshow_name_attributesrl_clear_messagerl_get_keymap_namerl_vi_insertion_modedispose_function_defhash_copystop_pipelinecopy_redirectcheck_dev_tty_rl_start_using_historyzresetmake_new_array_variable_rl_history_preserve_pointjobs_builtinarray_copy_rl_fix_pointtteightbitstrvec_resizefree_mail_filesecho_docbuiltin_address_internalrl_delete_textextract_command_substglob_ignore_caserl_free_line_statesplit_at_delimsphash_insert_rl_move_cursor_relativecheck_bash_inputdispose_exec_redirects_rl_insert_charbash_default_completionparse_and_execute_levelmail_warningsource_uses_pathcommand_oriented_historyrl_end_of_historyall_digits_rl_init_eightbitsignal_namerl_replace_from_history_rl_uppercase_prelease_statusgetopts_resetlegal_alias_name_rl_term_DCsh_invalidoptnamerl_visible_statsrl_emacs_editing_modemap_overpop_dollar_varsrl_completion_quote_characterbind_var_to_intnotify_and_cleanup_rl_enable_keypaddispose_var_contextrl_startup_hookdispose_cond_nodestrvec_disposeunbind_array_elementreset_internal_getoptyycharit_commandspop_streamclear_historydont_save_function_defsquote_escapesfc_execute_fileexpand_aliasesdispose_variableshell_initializedprogramming_errorrl_char_is_quoted_pifs_firstc_lenloop_levelmap_over_funcslong_args_rl_init_argumenthistory_basesh_physpathyyerrorbash_initialize_historypopd_builtinGLIBC_2.1GLIBC_2.0GLIBC_2.3GLIBC_2.2GLIBC_2.3.4/lib/ld-linux.so.20ii pii pii pii pii pti pii p A  W 9 D > E      % 2 : H \ h j$ m( w, z0 4 8 < @ D H L P T X \  ` d h !l )p 4t =x P| T g i u              ą  ȅ ̅ #Ѕ 1ԅ :؅ ?܅ Q ^ b c g m r x {         $ ( , S0 V4 a8 t< z@ ~D H L P T X \ ` d h l p t x | $ ) * M T i s x          Ć Ȇ ̆ І Ԇ $؆ )܆ 0 6 > E K N i p t v        $ ( , 0 4 8 < @ D H L P T X \ (` /d 6h ;l Bp Dt Qx h| ~                  "ć $ȇ &̇ +Ї .ԇ F؇ GU 75 % % h% h% h% h% h % h(% h0% h8p% h@`% hHP%$ hP@%( hX0%, h` %0 hh%4 hp%8 hx%< h%@ h%D h%H h%L h%P h%T h%X hp%\ h`%` hP%d h@%h h0%l h %p h%t h%x h%| h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h%ą h%ȅ h%̅ h%Ѕ h%ԅ h%؅ hp%܅ h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`% hHP%$ hP@%( hX0%, h` %0 hh%4 hp%8 hx%< h%@ h%D h%H h%L h%P h%T h%X hp%\ h`%` hP%d h@%h h0%l h %p h%t h%x h%| h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h%Ć h%Ȇ h%̆ h%І h%Ԇ h%؆ hp%܆ h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`% hHP%$ hP@%( hX0%, h` %0 hh%4 hp%8 hx%< h%@ h%D h%H h%L h%P h%T h%X hp%\ h`%` hP%d h@%h h0%l h %p h%t h%x h%| h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h%ć h%ȇ h%̇ h%Ї h%ԇ h%؇ hp1^PTRh47 h6 QVh#US[RtX[ÐU= tv ҡ u ÉU tt h ЃvÐUE$US]$軦u u&tF$t t t̋ t‹ t"뱐&aUS0 D$$9 0 >0  []USt8u[]D$$}.t8u$[]D$$UWVS  t [^_]ËE1ۉ$l8rt ؃ [^_]ÿ:8 uUWVS E$2 1:-…u":rt [^_]ø:8 ։u$F0 `B$_ TB$E8 HB$@8 uxu  ;8 $v$,E 9 4>-Dž~- Džtl1 tT 8FuލFT$$Hu˃$ {  k,  K 9 t 48  ҉M0 y $ E94-€+ Шr-^'C/$; 9` lt&h~eDžS$9 S\M$vOqzuRR  9zh R     $Q$7$$D$ 7;t4uȉE4 t 1= $et ((t $  t= A 5<t"E 8mEEД  8u; u1E;$t t $$^ t t$~ @ ta1*@ 1|-D$ډ$e ; |Ρ@ $@    o賂$^= 5 < 1  }D$4$L$g= 15  $b)K E50 D$E܉$!Zt.H $Z0 EE E܅҉E$&9 G$*9 G  $[  E   0 0 1 ( !  8> $#$W= >P D$$l$'I {$n 1ۅt 8e  $.9 X1t"D$\$$49 ;Ѓۣ$Džt ;tW  y= 1 1t# u, ( ( = u  V H  ty>ut, ( >ucD$$;9   u2D$$H9 >u-D$$X9 >uD$$f9  O (   = , 4$V 0 = 1 5     89 E;$t  N $v$s5 Z > >D$< $$UD$$ W ҉EtEu    l$R ۣ  $Ft<-Z~vM $f$>    ]D$-$i DD$ $$ 聲aD$A $8 ^$8 F $1 $$8*|$ՠ= wD$$1߹щ $\$$5  2t(D$A $8 $8 EUwBtt& u " E1щ $X\$$AD$$[߉$1щ $\$$$q9 ?@x$z9 @X$9 @pD$$L$t4PÉ$\$蒉D$ÉD$4$y$$D$9 D$<$Y4$>u+D$ D$D$4$!ЃD$D$ $讁D$ D$$ 1r 14$LEE= .  t= f5 X  B$@8 , $( { D$D$9 $\$T$$Z1ҡ $ 9 <8&$ Z1~$D$${$c z$u/)9 XQ{8dƸ9 yDžjv4 <d 9  @ Lƒ .(\$$Gt &dD$$;9 = u8D$$H9  D$$X9 D$$f9 j D$@ $a@ 1-$D$1>111-$D$W   $E8 v( D$D$9 $! $T$VyD$Pt$$~D$4$}D$ D$D$$] $~1$FB$JD$<$tP D$$^$U D$4$E  8 K$ů$UE  l D$D$`; $cD$z8 $TD$D$`; $2 T$ˋw)T$$(D$u8%=@t?4$T$~E$; D$TD$D$9 $qL$$ΐUD$D$`< $2$ y$USW} t*=t!$<  t$=$t/rXáu[] []$V  tD$ D$< $$< WUW1V1S$  Eue"uT ɉ1t#~$ED$$[^_]Ė$< % .t@tD$ D$ D$$%.VD$p$賔E<$+2US$E  E D$$! &t@E OD$ \$D$$< dT  Ku] u $ p E 2  (l- $[]á u 뵃D0 Et  E "pf$D$s$$t&l]E$艪ET   h$E:E$:E# l$ zEU]U]Uu*É$UWSE]uJ1t щ $mz\$$VEEE [_]É$묡Uu= ]U ]UWS $}1ۅ  u'_ $$ }ut-\$$А  1$ӍCD$y D   < $  uԋ R , D$1ۉ$ $|D$s$ÃA [_]Ã[_]Ë U҉t tB ED E]Ux U9Pt u1]ø]U=t$tá D$ = D$D$D$9$VËU҉tt]ø]U QEA]UED$D$D$E $D$ UuÉ$d{ɍvUD$E${UED$D$qD$E $MD$ oUS$ vD$Í@$D$*=Ct@| MCɡx  x t | []á.xD$$CUSx u []Ë x C D$CD$ CD$CD$C$u=t'C| Cu$[]É$.xΡp!t= p!x*‹C$D$D$C$D$tU$ quP T PX PUUtP BT BX ]UVSt C t`$tC3tމ$t [^]U]뭋l Uny ҉Su9T )t1tH` 1Ʌt9` uQ= []Ã=X (e .t\ uQ= ދ X e .tʁ u    < <  Шu< it< [][e ]À| ne .v< ݋ UɉSt tB \ []É []US1ۃ=t# $܀u݃[]U="=}G)g(}= t8hH=t&'=}=t|/- t&w!]=|=~=$.t1]Ã;.tՍv|{ƒ&vܡP U{t3&t,~1(t&t ;t1]= t~-t&w]Åt -Ul  t p \ u2 u7D u]D P  @   tɉ$D    t$D P  @  UWVS1ۃ }t37݀ t :uD$<$u܃ [^_]à [^_]ËU҉t ;t]U}t ]U D$ $Q $UWVSDžL0$0pDžHDE0E 1!?U:!K$L$rmÅtELD$D$ HT$D$4DHD}7}eh 54 Eءl Eܡp l Eࡨ h  p u !D5lD$$NGDÉ$$育$D袝5lEأh Eܣl Ep D[^_]Ã\t_HLH9|-B09}DLD$<$oDHDHH}7F߃Vw$|O $n\CCQ$nf!9D $D@<$@D$V ED$XDž$D$$$WƄXEX$kXD$$4 u X $j$L$pMT $T$p$m@á4 u t\ t@\@\ @B$K댡 $蝿$%Dž@V t$j@1@щ $m@T$$p$l= $ = $ $laDeGrC $jù1щ $wl\$^P$E$荾detTt&@A7<ƅX1Xщ $kXh <1щ $kh $kv4 D$= $D$ 8 D$TED$$D$$ƅW<$Bk<ƒ< Шt 1Eu$bEUB]tpD$D$T= 5D$D$k= <|.D$D$PS $覴\$D$| $7$y= <  €  Шt:tn  €  Шu t|$\$4$*E .tۍt&t+{t$u$x= D$菞t9.  €  Шt,9.  €  Шuހ td t&VUS]\ C C` C CH C"ClC$= t@u/C C$C( C, C0؃[]Ë@tʉ$C $4_1PUVS]tz\ CC C ` CCH C"C$= lt@u'C$C(C, C0 [^]Ë@t҉$ƗC F‰$C$bUWVES\u$f$,n t$1߹щ $^\$$论1щ $^t$$芺D$D$< $E$\$$,n Bt$;=@  t\[^_]@ \[^_]UWVS, 1ӍCEܡ $1]1ۣ EE{  ;]EUEU䡜 < 0؍U)T$ L$$D$ ƒ Шut:v{EU1ɉEUw ;U|,[^_]1ɍ{P$ ;U|,[^_]UWVSE "D t [^_]Ë5 6| " 1  B t t Bǡ"tK 9|'9} D$ $W\   u   |H 5 w>nl ="th |'4$D$D$H5 ="9tK4$1ۉ tэA£  5 :5   "" s 1ۅ hu < t \1}t < [t 'BJ Bɣ B B P \ t B t`$贳   B [^_]rl&rr2- $ct =+u   Y>=l th |k.8; $= t1>u =  t$D$5 $5  tW  B9>~$A4$ AD$X ƣ    D5   $= D=  ~ |  %\ "4$bt W4$iUWVSL"EUEEEEt EE$@ W@E1| E0}'E1 k~E;1}'.U؅u, wE؅uƒ ШtF /G9|@9}t$EЉ$VEЋU! |u;]sE9E1}t2}{1;]t  |U1;]t  |W9U|@9u}t$EЉ$ VEЋUЈ}'}\E9E  Gl  p B9Wh E܃l 1'v ~ |[EȃUD$؉T$ډ$-l É}t E܅1'0 u Mȅk ~ |PED$ ED$D$Ẻ$謅Ủlj$.U<$~Ẻ<$+1}эA}ĉEt79|@9}t$UЉ$jTEЋẺD$E$}E̅t Ủ$í$E ~ |EEU:] tE 8EЃL[^_]ÍG9|@9}t$UЉ$SEЃƒ Шt ~ |uUЈEEEM |)l  p B9A p D$h $7Sl h E܃l 1'EEUЉ$bD$D$xS $VUD$T$Eԉ$( t L[^_]á |kKaU1\ ~ |E ~ |rm}"1` ~ |EȍU$`D$T$1`=t ExEt;E9|@9}t$EЉ$QEЋỦT$EEĉ$}}E̅.Ẻ$ת ~ |HE ШP =!=#= }}~ U|c=P  M}Pl tMl 9e\ tE\ 8{}v5p tP gt }?}}t M9]msK1ۃ<1> m9Ɖ&t  |>1&t  |<1>t m |]>1|t 2 |">1&t  |)(\ D1)  ~ | \  u>1<u (.O ~ |4t:}@ƒ}* Ш}+ƒ}? Ш}!}$ƒ}< Ш}>}[1}t)P =t=$tt \  }=1}5E t  |E0 e1}$ Ẽ}ƒ} Шt}ԡ }ԋMU Mԋh 9~9}h D$ $E} W J9/EE0 5E-  ~ |1 tEƒ}` Шu}"t @tEE({ƒ[ Ш}$j}$1$ ~ |$ND@$$@Mԉáh 9|,9} h T$$kD \$E $EEE( ~ |l  p B9h (ED$D$$)(El -l =t  Eԋh E9|.с9}  h L$$pC MU  (ȉMԉ\$ $˞}}ԅt$詜EE}$ 'ƒ" Ш ~ |l  p =| B9h  1l '4$D$ED$-l =t \'xE|$ D$E$D$D$$貛E$A"Í@t$$蠝ED"EPUD4$rUMԍD h 9|.ց9} 5h t$$A \$E $+}}ԅt$ EE ET4U=D\ $ D$z9}ԉ ;UT;~ ~ |c(u  |p'A p D$h $@l h ;D$$$虑.f ~ |b{(l  p B9,h (ED$D$$)(El F-l Át Eԋh E9|.с9}  h L$$? MU  ȉMԉ\$ $MMԅt$EE =h 5| M}P  h 1ہ \  1)t9 y \$$zD1)uǡ  EU%\ x  h P Etޅ 4$߀E4$lMt)E }? 1эAEEԋh E9|.с9}  h L$$= Uԡ = (EUԅtЋM L$$Q}}ԋUԡ )EUԅ.2M $"= bQ>GED$$]D$[Ew3A p D$h $=l h  E4$3Mԅ % ~ | ED$$]D$[E=t Eԋh E9|.с9}  h L$$\< MU ȉMԉ\$ $×}}ԅ.$蜕A p D$h $;l h  h D$$; P =!=# Шw ~ |\- t  ~ |1t u1>t%\  EA p D$h $:l h >ED$ E$D$D$k$>4$d4$,1эQU\ | \ ` $+Fd = 0=t-D$D$S $诌D$` $Č[^_]É1)= ~ |"y]yu  ME{D$D$$}1= }}~ U|txM MupP Htb 1tW= ‰} t<M8uT$ $u؋\ 4 %= 1}t^\ = }uP =t=$tt .v6 Eu ~ |U UP 0 1 ‰M d}8uT$<$Ήuԋ\ $4 >'~\ E$fE.UBJ1M}֍FEF$6UÉT$$ՒM| tD u}ۉ;.MQ $` E~ U|E؉D$ $-}؋E؋U܉11 =6 $6ƋEԃ$6F D$$]̅tNMȅtN\  D$ $_.P N=Et=$;.\ t t P NU51ɋF} } }}tp@  @ | @ I T   Ш> 2T - oU:dczoYz t&@U:d9M9{ryhp {1EVo}|  \  m P ME8-5xp+Uz/)L $t$a x S$蔍FE8ixnxt&>u \ l < u%\ r$x| p  {>=P (<\ t;&(t&/P = w1ҍE"E1$1\ u \ (\ zoz st& ~ | >0D$D$S $i\$D$` $$<%\ @ D$D$T $4$D$d- Fp }|Ck= %\ }=T  ~ |\ |  \ ) \ $\ 4 ..t&{}p p E$z5@2D$$5E$耉'4 P|Ip t&ˀ| 1ң EhE$4D$$4E$ڈyD$D$@T Z&Pg(7'-#"! lP  u  u$G衻$UWV1SH E䡤"E茑| E = E E$ٶEP D$ E $E t \  1=)t; t$$_31=)uP  ԶEH EE "E=  EE t %\ x tvtu\[^_]á8>| $CL L | L t4$Zx E4$[^_]Ë= lu 5 u $.E$"EU1 d u, tw[1h d tUWVS=| =tO(D=tn=tL=xD$D$hT $~\$D$| $d 1[^_]Ë8!usxum$X`t[^_]D$D$T $%~t$D$| $x4$l$H1===D$ D$D$$6D$D$ |$$-@=d )D$ D$D$$b6D$ D$D$$/6E1=<ƒ> Ш Шuƒ) Ш1$= /D$ NjE$D$|$5Ɖd Bt$,Xd 3D$D$T $^|t$<$D$9D$D$T $/1=D$ D$D$$4D$ E|$$D$q<$V}D$D$U ~D$D$= ${<$D$$iEtk=5D$D$PU $9{t$D$| $4$ E$V<$5Um 9=A~uAD$D$U $zD$| $Mt{D$D$U $|zt$D$| $4$OE$UD$D$U $3zD$| $D$D$,V $zD$| $XUS=d t[]\$D$D$ $2Ã[]US=d t[]\$D$D$ $Y2Ã[]U]UWVXS  DžDžDžDžDž  Njfҋ D ;)ѽ''v Dž'D%)čD$à ? $L$D$<} ^|$T$ $ } tL|9ΉH M RtC 1=)wK Ӂ[w G 9 A t@@ )NjL$P CDž+ 9e  M R.t[wf G u`B ~_W=  SG8D$&D$G$)>tZ? )Ǎ6)W? [wf9 G Z>   ` e[^_]á tT L ƒ  ШtC =@ u t>w` L T X P  P T 1ML  A1 C`B ._@ t  W $k= 荾^`B E 9u$= &D$$'@ @ T$ WD$T$G$'@ .@ $= &D$$&@ @ T$ WD$T$G؉$'@ .R@ E$= &D$$L&@ @ T$ WD$T$G؉$6'@ .@ D$ H D$G$/D$ $H D$/H D$D$ G$O/^H D$D$ $/-H D$D$ G$.H D$D$ $.D$|D$G$3%DžDžD$T$$>+W P? 8@  )G BBDž@ @ D$ GD$D$Gȉ$ %@ .@ G؅t ¡@ @ D$ GT$D$G$$@ .g@ ZG؅t <¡@ @ D$ GT$D$G$U$@ . @ D$H D$G$,D$$H D$,D$ H D$G$u,D$ $H D$K,ZD$H D$G$",1D$$H D$+D$H D$G$+D$$H D$+G BBG BHqDžb 1G`  1D$H D$G$+D$H D$G$*GD$G$7&{GD$G$&^QD7WB .‹uO$,GD$WT$$&D$WT$$&W‹uGzDžcDžLDž5D$ H D$G$( D$ $H D$(D$ $H D$(D$$H D$(D$$H D$U(dGD$$vHD$$Y+=   5d  t 9` ^ m$f1uD$H D$G$' D$$H D$^' WD$;D$G$3G8\ D$&D$G$D$D$G$G$ GD$GD$G$!GD$GD$G؉$!D$GD$G$!\G$Z(HBWB  ‹uO  D$  D$D$G$/' D$  D$D$G$' D$  D$D$G$&@ @ D$GD$G$@ .M@ @@ @ D$GD$G؉$i@ . @ @ D$@ D$G$%@ .@ G؅t  ¡@ @ D$ GT$D$G$@ .l@ _G؅t ¡@ @ D$ GT$D$G$y@ .@ $= D$$ @ @ T$ WD$T$G؉$@ .@ $= wD$$@ @ T$ WD$T$G؉$@ .J@ =$= D$$D@ @ T$ WD$T$G$M@ .@ $= D$$@ @ T$ WD$T$G$@ .@ u D$GD$G$@ .F@ 9 D$GD$G$@ . @  D$GD$G؉$@ .@  D$GD$G؉$O@ .@ @ @ D$ GD$D$Gȉ$@ .G@ :D$H D$G$!D$$H D$ D$H D$G$  D$$H D$o  hD$H D$G$0 ?D$$H D$ $= D$$@ @ T$ WD$T$G$@ .@ G8D$&D$G$$reDž;VDž G:D$;D$G$D$;D$G$G8D$&D$G$tD$D$G$PD$D$G$,zWd蹚ZE蚚;Dž),D$D$G$D$G$D$G$GD$GD$G$D$GD$G$tD$D$G${PGB$-D$$>WGOD$G$D$G$GD$$Wv84E$= 蛩D$&D$G$ ,D$&D$G$1 B D$&D$G$D$&D$G$B u$BD$D$= $^ 4 uA D$ T$$ ^` L  P   腤1$荹j$耹$svHUEt ] ܟ  á ]؟  UW1V1SE] t €  Шt u 1Ҁ-1+ tUt3 t,A< w%׃0׃u͋Mt؃ڃ[^_] UWV}St!;ut EUW,[^_]Ã,1[^_]UWVS }ttcӋDPu_t 1[^_]_wu  [^_]cBu_.uȃuUS]Cu$t2D$D$}V $ZT$$51[]ËM u []Ë$.tUS] t9 u3u.$€< Шu>t/t u[][1]UWV1S }]~bӋDPu_tE €[ 1Ҩu7}t/=t6[t&t0=bӋPu_u 7u1҃ [^_]Ét$<$7P1҃<8]uـ<=t1US]D$D$$^x1u[]À$D$D$Z^[]UED$D$$/^UD$$V >^x $rXá $CX$V.tD$$^UWVS}t^Et~u_V11Dž$ u#u_\OXFXV\11 u Dž$$[^_]ËEu$t$D$y\1҅uӉ{E ($t$D$O\1҅uuWUWVSE} 1t0ut$D$$\t1uӃ19]u E[^_]É\$E$\.tޅt $V;Et E$V[^_]X~=G=3UWV1S } 9}+E0 tG_ӋP u@t9|1 [^_]øUS1ۃtED$E$D$ZuE%=@tt[]ót[]UV1S]$u [^]D$$uf[^]UWSE ]t ;/t\$D$$[_]1щ $\$$^[_]USMtt 1эy~(|$\$$Xu;t51щ $|t$$eWC [^_]$QC [^_]$/UW1VS1ۃ,EE} uэy9s,U $$"t)vTw*9rԃ,[^_]Ã't`u׃NSv֋EUMEUU )؉L$ ډD$$T$ Q@wEUEU뎃NuzKUS]$y\$$[]UEEEE$U ~ P  EBE $‹EBE US] $U@X@ []UWVS u} ]$eX pxE E [^_]UWVSEE }]E$ UpXx PE EE[^_];US] MEEUM ]1[]US] MEEUM ][]lUt8u1É$OH2D$$|UWVS,EEEU MEU@MEE €  Шt €  Шuɉ€; <;u19E}}t&t <$vQ;u}$vUPEKCELC E܅MMCEK$J%] E ,[^_]}hxEYD$4$)D$E}AE"2E}vD$D$V $ID$M $D$D$W $IMQD$T$E$l,1[^_]D$D$W $7ID$E$눸jo zjo kjo \U$UPD$$ &UWVS Eu ]E$XEGtuG } E [^_]4$ѣG } E [^_]UVSu$ PtuCE C[^]É4$sCE C[^]UWVS ]u }$Xpx E E [^_] UVSӃ$ UXP4$D$[^]UE UE]UE UE]US$R$ D| CPUP C C[]U$| PUPU P UPUPUS]$1҅ۉX @ @tSP[]US$$u| CP@ @C C[]UVSutQEu)E t‹uF@ FU P [^]Ë^CD$E$C[^]>UWVS,EH 1t6D$D$W $EMQ $T$,[^_]1EEEED$UB$>E}1уMMA$KEUP@@E؋E؉$E| t+71t#E.E:< tUU:1Uэq<;}|'E܅EE܉D$M $EEEt$\$$6I}E؉$F7MUM UMB,[^_]Ã< .>< t/MT$$L$G.E< !됋UD$<$T$GM< .g7A$dUB$OE@UWVS,] $,ƋEF^ EF$W F,[^_]FE1эA<-uU$1uw1 F FA,[^_]FB,[^_]FA,[^_]FD$D$DW $KB\$$DED$U$mE虉EEUU3E}1 ME$1 F EFUWVSUE] UEu$UljX EwGSG$z9 {t7@t1@vt'HP |~ID$D$$,G|$U$貉G} E[^_]mvU$UPD$$ 8US];/t1D$/$'FtXD$$$ ?t[]D$$$?uС $D$B.tΉ\$$W JE[]UVSut… Шt^tE\$ ED$,X D$ $<9t t $C E[^_]<\$ ED$O> D$빉4$_t(4$[ T$$?[4$ZD$D$4$c;UVSu ]u]ޅt=Ft;ube u'_ D$ D$5X $;6uá E E [^] @ T$$?늉$ptF$øe u'_ D$ \$D$J\ $D;$B6w$u4e u'_ D$ \$D$J\ $:67D$D$$*eU$ trUS] T$$3>CD$:X D$ $:D$C $c[]US]_ T$$=CD$EX D$ $-:D$C $ []U  T$$=E@D$SX D$ $9UWVS UE] UEu} T$$%= D$D$D$ $_X Au7t\ EE EEcX [^_]A D$D$D$ $hX AuUD$F D$ $8 D$>u`kX $`uẼEEgsttD$D$TY $6\$$9@ẼEx_ED$ $D$D$dE}1эyEEljE܍EE%E}D$D$wX <$>}USÃh 9|&B9É}h D$d $6d d 1҅>d  d d $[]U ~ D<&<  Шu $< UW1VSà pP@ wX$Y  $ D$D$C$$zX ÉD$@$; [^_]ÿ,F:CD$X u'_ D$$X CD$C$J\ D$ [^_]ÃtT$$b $X D$ [^_]$e X$X D$v˃tT$$b _$X D$M뢋T$$X D$5XT$$X D$=t$T$$X $t$T$$X  T$$X D$T$$X D$tT$$b $X D$tT$$b l$X D$Z$X D$CT$$X .t$T$$X 8t$T$$X T$$b sC$ ƉD$X u'_ D$$X 4$<9C$zX D$T$$b yT$$b dsUW1V1Sà  >u-u {xt=$e K ƒ ШtÉ$覫tiƋuÅt9$e $ny 6u<$   [^_]C C ^ljUUSÃ$ny c t;u[]É\$$G: :[]Ue S]CC u[]$e C []USÃdCtuC$e C $G: D$$e [t$hX wCu$oX cCd$X O[]ËCJ$X 먋C9$X 뗋C $G: D$$e [vuC $G: D$US]$_X E []US]$Y غe E []UE@$X D$cUS]C$EX D$BC e []US]C$:X D$C e []kUWVS  Fuou] w t&$Y D$ D$D$$X ҲF u[^_]$e ~F [^_]$hX c$Y UFy$ Y =Fe O$'_ 놋^$$< OY   C +   M'$oX F@ $X ^$Y Ce $P= iC e $P= PCe $ 7OY   C1F$-qF@$H^^ $Y    C $ny  +  >$ - F= Q^1C$Y D$SD$$s $*Y )   C $EÃ;   + -  .Y Vk{ $gF$x^$1Y C $5Y x  Cf { +  b< F @%VB |&;vD$D$|Y $*VR $T$VB#F< ^$C tsá  '_  C 7 t<  t$ny $X $e $< UWVS   E}U Ut 8$JY Y   *Y uY $ E $N1Ã; t{EU-   .Y ezs 5 u ~ $b[^_]$ny   TCs C @}EU-   u zD$$F =FD$F$/bUSÃT$$F C $NY   C +  [ ]9U E  U E$$G: D$*UE D$ED$ $(ÐUS]un 9 }T1߃߃߃߃߃߃߃߃3   []É][]6$>,눃UVSut56C w$$Z C$ ,C$;$+u˃[^]UVSutn6C$ 9 }Y1߃߃߃߃߃߃߃߃.   u[^]É$Pzt&US]tUCuCu#C u+][]"+$Ct݉$C tՉ$8][]*[]UWVSuF u@ w v$pZ D$ D$D$$Z Bu[^_]*$O붋F@$F$k*u[^_]\*^C$eC$Z$;*΃[^_]Ë^C$_C $,Cȋ^C$C $C$C럋F$=^C$$뇋F$^C$C $g$V^C$C$C *~G$_ "C$kC$c؋$@)uډ<$4)US]C$VC $&Cu[]ÉE[](US]$][](UVSu$É0u@[^]É4$Ct$D$$([^]US]Cu ][]_($W(][]J(UVSut1ۃ~F<u9[^]É$ F9ߡ UtA u7 u$ t# t t >uB]@á tӡ| ]U w$\ 1]ø]US]D$$~][]5Ut uÉ$t UED$$D$&$USD$$Z I%~D$$$$k[]Ð} $C D$D$\ $\$$USӃx$x$[]UW1VSEԾ.(E< Uԍ@0E< U;u~ӋEt EsUԉ:<[^_]UWVSU$٭E  EY  $ 1׹щ $ T$$& … Шu+E11t EU$|؉[^_]ËED$UB$EÉ̉$7$]$pE11.tE[^_]UWVS,EFN 1ۋx=8=xE8= D$F@ $/E\$F@ $o EtXED$|$$Iáȋ 9EtE$#ȋ 9t<$"ut؃,[^_]ËED$ |$D$1ۋF $똀x|;T$#D$+$rI20$g;|0$R$*U|$T$$[ B<$~ 8$"Ɖ$."D$ƉL$ |$D$$";<$29! $;},:;}58< <  Шu;58 1 i `;Q588Ɖ$~.XD$ T$Ɖ|$ $D$;.)888.:uT8L8 x.j8 .N:uT81D$D$; $U$T$~8t$|$$mgD$D$[ $it)T$U$T$a.4$/'_ UVSӃD$D$$] $ \$t$$ [^]UVSÃt$D$$Sxs~ $t&/t*t,D$4$%x_ƒ Шu?[^]D$$y[^])1҉ 낉4$[^]úUWVSut=uu $ t 1Ĝ[^_]E^0 ؉5 ƒE1 u, }ƒ} Шu E 4$)4$ǹ1щ $i\$$RU T$$EUw1}M D$ $PM  uE^$J&@8EUMD$T$U $Àt?E EU^MD$T$ L$D$4$,ljVF D$$"x Et EE EYE؅tU$!T$EԅtM$}L$FE" $\ MtFFL*NjE؅tMD$ $VE؉$Eԅt Uԉ$M M`Et=lrl  MtF | ^҉E = Ct= t+ |  $.>t$1= щ $蓸 T$$v芹5 …1>u=lEϣ| }tF^5  | MY Ct t+ | C $>t$1= щ $躷 T$$豸 …E| 1E CEfvF|tHUEMT$L$ D$D$|B$EtFF4pEUMD$$U L$%6MUtFF)3Fpx D$4$s t  | E$BE EN}5V҉|t N|Ft| v|| UAۋMỦME Et t+ | | $t 8t >t$j= 1щ $k T$$Nb ҉E…1]|Ert F@E @  EM1Ƀ}ƒ} Ш E 1}t } W | 8 El 1J SBtuD$F$ @hSt&벋EtFF11EtFFE.]tFF!eEtFF2K$&*hF eEUMD$T$1҉ $ ljqx $x K$U҉t=l%$辀Eԡt $t $藀Eءx $x $6[ D$ D$D$$H[ <'$6[ 蛾EUMD$$U L$$ $X[ e@ yEϣ| Z @ 1}tE; E܅1}tE1 E E T G :=l{$NUMET$L$ D$D$4$pv|$=t@@E|$$K1)M D$ $U   $C$ ǡ ED$G$#<$֋UÉ| "} F|$B蹳E|p4$肒l Eċ}ą1$d[ 譻 |EEu? MċA$ <EEt= u5E$ȆD$!" Uċ2t ‹uBUċZE8%1Ƀ} t8M Mu0u,t&|B 1}t }.1" E1} MɣE…  ШEW@E t!|1 }\|p Q M D$EL$D$EȋM̉D$ EL$D$MEĉ $-p = 1щ $覭 T$$ ||ER EUUĉߋB@0 tD$/4$4$erEtZM $]1}t}t=1}щ $UT$$M $L$ٯE t 1}Et U$8E̋UE  t  EtMD$ $AE t }"D$D$v[ $t$$^$50 1^|B 2D$$賅} x &"t$[ 蝷\$$!y}x UċED$4$nơ $>t $B}n tx $[ 9x >t$Zx uE=~7}th}h1]Et   1}t >tSE$vEJ]t E$HUĉ$Q$d[ kMh}tP}~E땁= t$t $[ t x EMUD$$H!Uf T 11Ej<$,lE|r4$vEW1= щ $: T$$U $T$ur|E @}} ƒEt E$kUE|ErE UE 1aMu|Z M t1Ƀ}ƒ} ШuL$$x6UȋE"D$$:$D$D$[ $T$$}7=l1?lnUċB$E.E $$D$>áx $x uM0; @ tlUE.1E$`sM%7F,"8%P$NE̋U41녋|qD$D$D] $pt$${1}lt}.tUȋEu.M $ E$腀YOt&M [ us[ $+Uģ$ЉE:|B $ZUċZ ֿ[ 8)ֿ[ ׋EċXx $x ED$ D$D$$ D$T$U$$`$EL蟽)MUċED$ D$L$4$9*$.t t }UWVS$Bt&ѣW5H $C蓣S$C裣?L E9$A肣D  UD$ED$$hS1߹щ $p\$$Y$Y ÉD$B\$$Q2}$(TUBU䣀 | EED$$:E8 EEH$[ T 5 踟á … ШuX k1щ $it$$R$Y ƉD$;t$$Q+UE 5 $ D$D$ D$D$5 蒟5 V@@U1׹щ $UЉT$$EЉD$$Y 莩}$|Q|${nUVS$ $[ h$7\$DU E\$D$ D$$Ɖ$$[ 7[^]UWVS1ۃE} u  Jtnt&T賒t4$DUED$<$xvu$EtPD$$!tcti$p됡} ШKDEUD$ D$E t$$E $l$E UD$$E=uf$UW1VSÃ,Up ҋutP1 ySE1; |sEEct. $  t  E}  V EkEt E$U Et5hC ; CEt9tH]t%U ƒ  ШtUBcU dBƒUUB1`Ut؋E-p ,[^_]øD$$s C $; C !C@C $&t$hEUD$ D$ED$T$$.0D$$@ $l$ C $stfk@BB@{1}$cUWVSx <|$$7U$T$L$$~^<%4%FET$D$E 4$D$ ED$^H|$p8Dž@DžPDž`DžDDžTDžd<$jt$$\$$xhL$|$$芣dhD$`$D$-xL$\$$LUT$Ét$<$X1D$\$4$nT4$D$PD$ʤxD$ $D$ÍP<$D$ED$Ȣ\$HD$$DD$@$D$[h\$t$$[ Ƌ4:;9 `d0P,($T@D 1эAߍp@4$Dž tY%9|"@9} t$ $  u L$D$5 0$0 $ $8 [^_]GO<%9|@9} t$ $4   )'~ Dž'Q$ꋅ)RT$ȋк)D$9@9}(,L$rDž% $L$HD$D$x] $T$$h $zUVS l $ $w 芞$7\$f\$D$ D$D$E$$$w X t [^] [^]UWVSÃ,| ED$C$ʼnu5 u ,[^_]á ul$艪CEC $DtEE$< 蒝U$ȆT$k1}C $| n 5t >ta= 1щ $ T$$= 1tMUU"N蘩DCH-$hR$oeUBD$E$D$P@C$ ɉ"ur:*EU-| $۽$< ,[^_]ÿUf 藨sU| t5 u  u0E$p$< 芛-yVl$ UWVSE| EtGH GY ɉEt | UGEE| [^_] "G$E"t{EU| GEtZEU| G ËEօt< Eɣ| YO+ ަrҦKEE-| E[^_]ÃUWVS|ED$@$mu |[^_]Ëu | FM | 4$R 1= щ $- T$$$ ɉ11Ʌa}GE܋G $zoE$6;UEԅ… ШttAtHAtH="A$"EU MD$T$ L$D$F@$É؁L[^_]- D$ A D$$S\ D$DW$}h$$D$$\$L$$MF}t >1tKUM $T$L$ |$D$x<$`D$$T$؉AA$á"Nq 1u1wt AtHA$VI1ɉ.D<A‹A tUM ET$L$ D$D$$ËAtAF@.tHUM $T$L$ UT$L$htPcF.x |. $+M9L$4UƋD$FD$B$0V$f\ t$$7͈t$$j轈x|$$4詈$4D$蓈L$$m}tC@tHt$|$D$ D$C@$ x<$$4$苭$f\ 6CX.;.CBH$BME VUL$D$ T$D$4$m芔v}cmNv:$|\ tQ%v該l=QUWVS u$'{1t щ $ {t$$ CCE C CC [^_]U  ]Up tCp ɐUVS]u Ct't t u-E EG: [^]7[^]É$MuCω$Ȧu@CD$D$C$ÉD$$G: ][^]C$3UE@t@uD$D$$j$G: D$US]KtNCuMu3$^ D$U$D$E []D$$[]Ë$G: D$ $?E []UVS1ۃut t@u$C[^]UWV1S }t4,$F D$$$ ,uЃ [^_]UE]UE]UE D$ $ou  $0,EUVS]$+,  $T$@zƋCuKs[^]É$Ks[^]UE D$ D$ D$$vEUSu4  imNA90Љ%9t []$ .ÉpUVS] $T$QyƋCuKs[^]É$Ks[^]UU t:uEEE| EÍE$D$HmtҋE| EUVS]p$T$xƋCu s[^]É$Is[^]UU t:uEEEp EÍE$D$ltҋEp EUVSp ]$T$#xƋCu s[^]É$s[^]U1WS=]щ $uT$$NjCu {[_]É$V{[_]UVS]$T$}wƋCu s[^]É$s[^]US]u t C[]ád $C[]UWS] t;D t$1щ $t\$$E[_]UE UD$D$ ET$$:EUWVS ]Ɖ$ѳNjC$Ӭ4$"{ [^_]UWVS }t [^_]ÍE1ۉ$v;] w.}ۋ\$4$D$ ؃D${;].} \$4$D$ ؃D$Q;]|׃[^_]UE]UT$D$$C[1҅tPU E]U1VSu] Su[u[^]USE ]u:"t( $D$1҅t X …u0[]átϋ tʼnF.tX …tЉ$P []U1 "u tD$E$YU$q9 tH tUt `ÁHU E]U1Ut BuBD$D$B$蕰UE$At E1U]UWVS $qù1щ $qt$$CCC CCC [^_]UWVSU| ۉEtI1щ $)qt$$UT$D$$FZUP[^_]D$$@ã  $VC|US ERDjCK[]UWVSà } $t [^_]É$‰p EBt zUWSE] @uH1t;u$p[_]߹щ $p\$$[_]ÍE$D$L}t$T$r[_]$臈UWVSE tHU<|$É$DCC8 ut  [^_]ÃCU.tHt)@u|$$D$D$ S[^_]Ë@uI@uC|$$ƋCuyCuFSusZ$CsG4$JGR$Cvjt$ D$D$C$D4$h$[CsUWVSE$tP umEtFt VEU t Ct9CtO[uD$D$` $$4C1[^_]á 9FuV[^_]Å.tSF@u tNut}<$|렅E}EuVFUBK }GO E8It E[^_]ÀxFuxSuxu<$t&/Eԋ}1щ $lUT$$}GyD$'_ C$EEb$R‰CUVSE$.t@t [^]LƋCusK[^]É$BUS]$t[]D$ U @$jUWVS  E uۉE uk t CutSVu*[uE U @E [^_]CE UE [^_].t@1}щ $[kUT$$ACCH$C4D$$@ã  $PC$pUS$]E\$D$ $T$l$9\ D$E \$D$ T$$lD$$?\ `$[]US$CUD$ T$$T$Ol$^ t`\$$^  H$[]UV1S$!= ctp$V Pt@utt t $^ 謊t&D$$V H $D$$V iH[^]ËX.tD$ D$D$ $tc\$>t&D$ D$D$ 4$>c@4$t$$V H MUVS0]$^ t 8iEEEr= q  2C0EEE$^ D$SH 0[^]ÃcRغgfffE)B0҈E)ӍC0EE$^ D$H 0[^]ÁuغQ)B0ER)Éމ]u$t$D$ D$ ?0E$t$D$ D$ @0EEE$^ D$PH 0[^]ÍE$D$]E D$D$D` $ T$$< RUVS]E cD$$ƋCu8Csu@8 t CCt  [^]ËC$hCst$VCUW1V1S ]$thfD$D$$Mt@ǃBt#E $D$肷tH [^_]ËE $D$ۉ$3UHED$D$ D$E D$ $蛜D$E$3UWVS E$+@uwFue] tU} <$3FF 8 ƒɉVtƒ ЀFt  $ ? [^_]F밉$됉$ھFuU1׹щ $dUT$$ D$$T$MËEƉCUWVS]} $8t$$u }[^_]g6G G E<$2ƋEG 1щ $)d\$$ D$T$$CMp[^_]UWVS,]D$$z\߉E1щ $c\$$謿EEU<= 7 E"@~E!ENF FF1һЉً}EуMtM9u1UD$ cMÉL$$E=}t U:ED^ U:I5 upU$萼,[^_]ÀytyhЉً}эAU$MF$AH MED$ D$L$$wizFUzSIz?4$ 2$ϻuMT$D $ǽ$t@@UMD$~\ $8t{D$$aD$$襲$EC E$8aEM $9E$1j1߹щ $`\$$nUS]tqCuPuYCueCu4$蝺Cu ][]銺 ][]s$k‹C$u뮋C$롃[]É$?US D$D$E$Høt6$ :Ct@u#$ C$$۹1[]à US D$D$E$lHøt$Ct$蘐C$肹$z1[]U]UED$B$RIUS t Ct9Ct [u[]Å.tCtCu C[]É$C$IUS]$JtPP[]D$'_ $ u׋PUVS$ ^Í$^sC[^]UWVS,EU0x%u1} EEP];UMMEEM@ɉEt U$U1}tyM1ۋqM܃~099~%E8uT$ $u99MQ9ɍBtx9|OEE܋U܋MB M܉AEEGMQE;U ,[^_]ËUBD$$r]MEEU1WVS ] }tQStB[ut<] CD$4$:[u4$芶 [^_]à 1[^_]UVS t@u 1[^]D$$á U3$,[^]US]$$D$ D$D$襲[]USEE )‰u L$$2[]US $T$t$r[]US$t$M[]U1]U1]UE]@ U\]U\]oU1҉E@ut]US1ۋMQu t 9At[]Àt[]U]U]U1ɉUBu t 9Bt]ñ]UVS5 t Ft9Ft4vuD$D$p` $g$/1[^]Å.t΋F.t@tFtËFD$$3$t4$U1҉E@ut]U]UWVSEt E8Ei1ۅt8u… 1ҨC1ۉ$D}EEteM8uRE $PËED$$nt} t$;$X$D$>  [^_]À~t~t1U э뒋E 늋E UED$$^ D$FUS]uCu][]鲩$誩Ct$2C$L:][]郩U UB]UVSE uD$E$2Épt1 D$$K CX  [^]US]CtF u t5S D$@$5 ; tJS P][]SS PUS Ct(Ct`K@ u8$[]D$D$` $U$#[]D$ C$&8D$D$` USE X$#؋ 9uB$y  []UE $D$ED$?US]Cu t:%SCD$ @$¡ 9 tC B][]C%C BUVS uCt\Ct@ uwCt"ubD$ C$6C$7$E] [^]vD$D$a $ŸE[^]"D$ 뜉$蒦|U  9&v   ÍB D$ $L /   UVSE u]t ]E u[^]aB ]E u[^]=U t uD$ $j  $xy  jU- $] U t  uË$y  UWVS]$^ Gt @E$^ &@@E11$CD$D$E$Džu؉4$|$LD$D$ËE$薅][^_]:@E$^ tExUVS $^ rt @$^ X1ۅ@@D$D$$tED$F$S@uEEEU2D$D$$襂$葁EUEU|ȃwÉ4$k [^]ËX$^ E1KUSEE )‰u L$$a[]UWVS }tL 1ۅt97E+Eu|$ $tJ ũ[^_]D$ D$D$$  넃.t‰}  [^_]UWVS] #D$CD$E$0u[uك[^_]ËP҉UtRуur t }9Gti}1щ $GUT$$ãËF$覡4$螡M $$$胡1[^_]à 1t t UBBuwMAAusE1щ $=GM$T$!D$S$T$U0}x$F$ߠ4$O$Ϡ|$ }GvU D$E$XU])UExCt D4<5(2U]$\U t t$n _E锁UE$t UVS]$t8u{St`[^]ÍE$D$$^ dD$d<$D$_ $] $] , 4X uD$ t$$D$?$_ X 9\ t$\ D$ t$$D$u?$_ $_ 1t.D$ C$3u  CD$$_ @ @GD$$_ @ @D$$_ @ @wD$$_ @ @D$$9 h@ 1@D$$_ F@ j@D$$_ $v@ @_ D$$J_ D$@$7m?^ D$@$7O?^ D$@$71?z9 D$@$7?9 D$@$7$q9 Ĭ[^_]É+dE_dE u$ u >(a`dD$$H du1=.Cd1щ $:dT$$誖C$] C H $] $] tD$$_ %< $&9 D$8 D$$*9 $ $ D$$蒾@ã  $CS$)l T$$_ \u 1щ $[9 T$$>$!=   :/>u $S,l 1щ $8l v` Ƌ``1EэL $8dÉT$$qM D `$t$TdD$|$${E|)d$H d}|>)|>D>(\$$_ H%$9 ;@$q9 HP@ F@7\$$_ [H$$V \.1߉ʉ҃U M $7\$Ɖ$ UD$$膚l Rvl $V D$ $U3Éơ 8.qD$$GOP$^ t&螻$!= D$*|(DD$D$da $ dL$$ US]$;LtD$$[]À{AuD$$UWVSL$= @tc@Et XH uU1;u }F]؋UD$ \$$T$[7t$D$ U$D$q;u |L[^_]ËE Ɖȉ׉11 1} 9E11x19K|9C G$迎U$T$6UԉGB RE9ӉU|9r;u .^]؋UD$ \$$T$s6t$D$ U$D$q;u |UԋBx G$U$T$\6G$= Xk9E1$GlU.]ؙD$ \$T$$5D$ Ut$$D$hpUueUED$$  ÐUS]$7SP[]UV1S]t)C$t$$ 9ۉutu [^]É4$U[^]UWVS u$2ËFCFCF C FCFCF wD$a FE1}щ $2VT$${CF$ C [^_]UV1S]t$U0Ƌutu [^]É$~[^]UVS$2ËFCFCF u$C F1҅u,FS1҅u3S[^]É$\1҉C Ft‹FS1҅t‰؉S[^]U$1D$E$U1WVS u$T1NjFGFGF G FGFGFGF  $a ^$0EUCBC$ts UEBtD$ 0ËF$gCF$2CE]6uȅt1EUB W [^_]É$G FFG$J0ËF@ C F@$CF@$C_뙋F$rG묋v$ /ËF$pCF붋^$/ƋC$LFw8v$ /ËF$FCFC_jFVGv$e/ËFCF$CF $C F$CF$C_v$ /ËF$C_^$.ƋC$XFC$JFC uOF wv$.ËF$|[]UWVS}3Xá  tz |$'_ utb D$ \$ t$D$b ${ED$E D$ $~ D$$ 0 u[^_]8{\$4$7{g |$'_ utb D$ t$D$b $:{f t$D$ob ${H$HU1SU ]!‹EE D$D$$-{E] Eb []U1UD$$!‹ D$zU< D$$D$z$4C D$ED$2UD$D$b $zUT$$UD$D$b $OzUT$$ÐU@uL$ ҉ ~D @tȉ$܀  @t$辀  랡 $蠀USÃT$$<$[]UVS  < <  Шu tH8tCۉD$t$L$ ;f tHۉD$tMD$$c zD$$@ w'_ ۉt$D$L$ ;f u'_ ۉD$u'_ UWVSà tIt5 €  Шt<t+t €  Шu t݅t ?t&u 11[^_]À u뽋  9$$O% P  $  P ߉P  P HP  P( P   Q1  щ $$\$$覀    $ VEá օ      AQ  A A  A A$  A A $( } [^_]D$D$c $v" ED$D$b $v ;$^} $Q}D$D$ c $@v D$ $# UVSXD$D$@ $zD$$@ Sxtd u@ uH  pM t E İ11[^]É$n| t$]|뮋E֋U Åt E XD$$@ D$Azİ[^]UWVSEE EtO҈UtE €}  ШtkEt$M ɈMt €  Шuۀ tր}]M}  u8   E Ĝ[^_]À} .t}]붉  |UDP}_E,0< vNU}=U1ɀ=E  E M  Ĝ[^_]Ë UUEEAu}#€}@ ШuӀ}_t̓mME ME  EU 0EEEjۋM9ˉ]E}EpEtppÉыEt4EE]uUUÄS#s${ˋHu_€@ Ш$C< TC<AWCMMEEBu}_tmE<[ENM m= 1щ $K T$$.{ UE $ ME UЉE  Eġ   Eȡ E̡  Eԡ( ( E= EUԋMģ EUEEȉ  E؋]̣( EuЃƒ= Ш  }]M   5$ RU$臫t@tH= t>}]]U$X}]5 $6}]1$蚫t 811ң $  $    {]EUw>v!D$D$'c $9pUEEUE}!}>~E$v .$v!D$D$?c $oNEU ME$    qC<v&@_?E1}$YYIoD$U$}eME<]EPU@E]EqD$D$E$mD$D$0 $n-D$D$E$o1Ҁ}<…t|ET1U 1҄xE€X ШtEEEE< . $tv<tM9=tiE >h>t0E8=tyE $D$D$4k}&1&t"Ef  E MM}|1|t.E1  E E$2}*1*t E }-€}+ Шt:]t'}-€}+ Шt:]t#=tmm uπUu1ۄtu €  ШtStS €  Шu t:}t]$Xc \$Vo E [tӋDPu _?}-E됋UUWVS\EE BvU-H+u(B $ M]lZEU\[^_]É ?= t!D$D$d $=k 5$ $t$Qǡ( <$q]u c = )EUFD$D$ac $j D$D$Dd $jEU\[^_]K؃ډEUEU\[^_]É ;t&Fˋ 5$  ]EE M̉Eġ Eȡ  Eԡ( ( E CwSEԃ  Eأ( ]u$t$ǡ( tX<$\psteEUУ E$  Eģ Eȣ Ẹ Eԣ Eأ(  b뚋]ur t$oUS !t4~tӉ[]Ӊщ[]} 1ۃ[]UWVS,=  EUt$EU,[^_]ËEU=  EU.uRƉЉ tuxNEE-E]e]щEً]E]E]܋U܉U!uD$D$mc $g4돸1҉KUWVS,EU *ƒ/ Шu %R/ƒ% Шt tt*t(/tK%uEUt$|$ $T$녋E]߉щEً]EىMU]EUt$|$ $T$>D$D$c $f3fEU,[^_]UWVS Ɖ׋ +ƒ- Шt0Y+t--u)׋ +ƒ- ШuЃ [^_]UWVS Ɖ׋ Cw4j t t׉Љ tĉ1뾃 [^_]UWVS Ɖ׋ Cƒ< Шu >~`t(vt7U܋E EU܋u؋}܉4$|$[á( t<$gE$g u <[^_]É$gڋE ƒ: ШV ؉Eu ( `á( փ= :( t!D$D$d $V`) E1t f( Qщ¡( ( EuӉΡ   }/~J}^(}|t&jU$fD$D$c $_p}-t&u)EUZ}*uE؋]߉щEً]܋EىM̋ỦE؉U&D$D$c $7_D$D$c $_E؋U!! tQE؋U܉t$|$ $T$z tE؋U܉t$|$ $T$WE؋U11HD$D$c $^댉U܋E 1E؋U D$D$c $9^[U= ,tÐt&= ,.u= ,tАU1@ M9t@ u1]ËD ]UWVS u] 1rt +t%4$t-1+t [^_]1-9F*w$$d ->u >t $dh [^_]Ã-u'm1-$:Ջ tɉ$ 뽃+uhUS<$ 11҉À=@ &D t@ <@ uء<tcts []U, 0 ]8  $ (             4    U1@ ! @ u]Ƃ oƂ ;Ƃ! ÐU$V "ttɐt&ø`e át  uD$$` a.t¸` U@ ]UD @ Mt D ]UWVSu-P X9t ډË9uu\C[^_]Íh$[`hD$$]$=`h\$D$$]녍D$$D$]C[^_]UWVSà $`9tC3t$`$`9u [^_]UD D @ Eu]É]UD u{D ɐáL UtUP tH]UWVS,1L u ,[^_]Íh1$^$D$-\<$^\$|$$\L 19}P  u,9||$D$$j\,[^_]É\$ ED$D$$.uL 9UH t-;, t%D$$YH D$$YUS1ۃ L 9}P tx t 9|[]D$@$bYD$P @$DY L US1ۃ L 9})P t@tx t8 L 9|׃[]D$@$XP x uD$@$XUWVSU1ҋ=L 9}FP t2H 9Ht#9quEt A uyu݃[^_]Ã9|[^_]UVSËut D t$9t9Xut x uxu[^]ÉJt1.tP [^@]UWVS} u1ҋEu][^_]Íh4$\D$4$DY$[\$t$$Y1ҋEtD$$D$Y[^_]UWVSh}$[D$$X4$r[t$\$$.Y1҉(t:|$$je D$Yt$D$$X[^_]D$D$f $T|$$yt$D$$X[^_]UVS$)Tt [^]ût$D$te $\UWVS,EU!}}M+;  t1;  -D$ ED$~e D$E$S}0P MX7U9؉]]U؉MtE9uEU҉E؉U;]t M츆e ue D$M $&SUU$ T$WM؅ME]uEEUP H 1} E… ШuMA<e `;]tEUMB 9A E4$D$U>{~t!~t1щʃOD$ '_ D$e )ЉD$U$RMA<t=t;]1}~C\;]EM;] Шt*4 t M$ L$U;]P MEXMH,[^_]áP UE@5,[^_]`$D$e D$`$RY`AP MƋx u @EM84$|$VP<$D$e D$E$oPML$C$SUD$D$T$ $=Y XZCD$e D$E$Pɸe cEPJ$`e +UD$D$T$ $e $X;]0E$OP MH?B9A'_ ED$D$D$ $e WP e ָң`DonegED$D$D$ $e [WUP @@D$oe D$M $N,[^_]`e I uT$D$e $T$D$e UMU t E;H t1á $E$1U MU E]UD$$D$$D$$rUD$$VD$$BD$$.U0 t%tD$@D$$2Nx1á $L̡ uFL $e D$T$UWVSL u [^_]Íh$_SD$$P<$GS|$\$$Q1 L 19} P t x ƃ9|8 9~&1ۋ L 9}P tx tj9||$D$$~P[^_]1ۋ L 9.}ЋP tx t t<H L ȡ t;H;58 .~ L o1҉; .tP 1҉f; .tƋP 8  8  U4 =etD$$4 eUut= t |lt= t"""t$|$t$|=-Yu$Ud!D$$#I$U1ɉ~у]É$U~ ]Àu1]U VSt'P 1PBtƋ9Pu[^]áP P9t щ‹9u[B^]UWVSh,$-P$D$]M<$P\$|$$Mx P t 9r t*y|$D$$M,[^_]ÉÉ|$D$$iM,[^_]U])U1҉]U 9Љ   9tgtb P u+x t2H ЅtL t@ Ãx .tx uΉiu݋  P 봋 P 룡 놡 UL t< t1P  t%y >u>u<  Ë t P  uL ty uL UVS L ]E tauWuZP ; 4; $NFF}u[^]N[^]áuP x uD$D$g $kGP R$T$ST$NP _$6#vU P SË@ 9Btxu@ 9BuB []UWVS,DžEu} h$L$D$J$L\$D$$nJ1҉$5P , b9BuZP 9X|$C$Ns uЃƒ ШtD$C$M멉|$4$M,[^_]É|$@$cGۉt: P x tht!P x 1upD$$D$AI,[^_]É|$4$F뽃ƒ ШtD$@$FkP BBjUWVSE P X9t ڋ9u95|D=U1X]C9]ut$<$读[^_]ÍD$$ P ǣ5UWVS,P t[L tQ1Dž9}P t@t&9|)-,[^_]É lju G5P  u @ vrt $ f L Qh4$4ID$4$dFD$4$TF$ I\$t$$FL Zx u HgD$$D$oF 1t'$~1 @)t$.m1 WN T$$E $ D$E5P 5P  A a $ D$E 1҉$.t5P D$$@$D$"f D$ $@B 1҉$y.5P D$$@|A 1҉; ^<$:t+5P @TDd| uD$ T$ D$0f $? $Q D$D$D$ $>f HUWVSLUEEE=  u… Шti@8u5d dtE\$$D$$Bt=~t ='1}E܍E$d>u9ruE}=BB  P 1EEEX` Eġ E 9XtFC …uC<u}EEt}t ă"Eȋ EЋ9Xux EE؋UE@ >u 9U>uE=E… Шtut}Ew 4 t u.E܃L[^_]1s>8 ]UܸuHvȋEԅt_E`@ EЅttz tNE̋UE؋EE@ =UE@ z u|Et uC$EtCu@g_|$/t Cl$wu84 =et,=-YZm<t $t&Ӌ P BB B$R P @$vM܅1׹щ $T$$~D$Mf D$$lID$$p5D$$ !D$$ D$$D$$D D$$t$$Y t$$QD $&U~L]1щ ${t$$dCD$D$Uf $*u$Mf zEsPBK$vuL| P E%$O$y$*Ð~C|$l_UVSG:0át3[^]1ҸU3[^]UVSL t[uR1ۋ59}J9}7P tx u@tD$$L Ƀ[^]áu;5.t߃1Ҹ[^]U1MUS]>Eڸ][]?US]Eڸ][]US]Eڸ][]U u u u á.uUW1VS  E u [^_]Íh$=D$$:D$$:D$$:D$$:4$r=t$\$$.;ED$0 $=x-E( t$D$$:[^_]ÿUED$TD$0 $=uUft EfuD$‰$xED$E$+U0 t8t"D$@$ ?x u1҉1[1 $5US.5£,    $ $?50  $-50 9tD$D$$:D$Sr$= $m-D$ e []á $4$u/$" P x dD$$D$4 [^_]á"v1 = % .C C.P @ 1҉8,t&, D$$GD$D$$3D$D$g $/|$$.[^_]ËCNjCD$3`$4 @t&a $ D$6 $."UWVSh,$.5D$$^2$5T$\$$2P M@ fU …pMP Ƌ`E MXE ;  +t1;  -D$ ED$~e D$ $-P }u9T D Dž}ttt gD$L$$$ ,[^_]19.^P  .M9|A.t  HtP{D$@$Vc$ # D 9ы9uD t ‰AыuH G H D GtG11ۋP Y 1y 9u1u ЃB $V ]Z1щ $8\$$!(E y AP AA A L $ 1L P  9|ZFL D$P $ L 9ΣP  9|h$yt&l$f 1$ : 8 ։)9})΅h$#$D$! $#|$\$$1!L 19}P tx tA9|uSD$$D$9!L Љ901҉; L 뢡L 11ۍ$L 9։P  t 9|99|$#T$D$P $n L nD$$=98L 8 EP eUD u* u$ u$f  H U$$OUq@ Ut]]@ SU0 t$$#UD$Sr$~UWVSh,$?!D$$oD$$_<$!|$\$$? tU t~$>l H u5H D$4$$D p@@ ۋE D A E t5 5 D$|$$,[^_]áH u, H s$)D$D$ "$ H u؉H ;, 5H $D$"} uH ;, tD$$H 9>uu x$  >yH8t&u9 D$\$$!t H u , H b U o 9t‹9u [$f 裛TD u r],H \$$f D$RU ];UWVS Eu tvE1ۀ8uvUM)9.​}4$D$;ƋE2U\$T$$M؉0}<$ [^_]Àxtxv1эY^PsUWV1SэL1M>uU2tdt})|$EE$t!}9\$E$uwBU2uU̅t M̉ $ t$}ԋD$E؉$r7\[^_]ËMEЋUM)MUL$ D$}$|${@EUEUp.p\$E$@|$E܋U$T$w,#M9u y.&\$}<$M̅)E܉D$M̉ $֐t&r@;MEE M}UэL1M<'u:\$UT$M؉ $p}Uԃ]mM \[^_]w%}<'uۋEԋE뗋U؋EȍM)؋u}T$L$ D$$@wu}랅tD$E$D$1!Í$Ẻ\$U$T$U1WVS,EEu1Eу9ωMsCE<\]w7E9}؃07;]|}U9Ur>,[^_]ËUM]EU؉M܍)؍MT$L$ D$$@w:E؋U܉EU|L`€\ Шu $OEFKUGUWVS>5U Et E 8 (EE … ШU :EE>M U $Z<Y.$jU܉$T$EEt@H$pE] tg €  Ш <tBEEEu1уMkEEÍ{L7tH €  Шu u1U t'zt}{L7u 1}t$U tz<E܅M܋> $gIt> €  Шu uU tzt!>uɉ 1<[^_]8.u8.5}E؅KE  1 . %$'_ ǃH$1E܉<$D$}EE{&륋E܃<[^_]ËMEUM̋MЉU)$ȍMT$L$ D$@w;EȋỦEUx x xEEÉE86  1  .CÉEUWVSu] ttUtk8tf1t ; U… Шu-;uO& €  Шu u1t%uӋ]Eۉ0tU21[^_]Ä.tEU$MɉE}U>E >tU €  ШE<>t2GljE( €  Шu ut]ߍ_L3u >1}t+t 1 t tGEǍ>UE[^_]À{ { {v 7)}UWVuS]t;uK9w0A[^_]À{t{Kt1эL9< <  Шu< t5.t,.uy <  Шu .u{€uUV1St)$5$t$ߺ  u׋ C$t$$謺ƅu߅tu [^]É4$b[^]U1=t u u]UWSM U~j t!ȃtu1[_]Å.tCE1}щ $ST$$[_]| t&wӋ1tщ $誳UVSMɉt$i$r[^]É$3$W[^]U1WVS1ۃlEE}EэD $EEEԋMtBƒ'B"t& ) w_MMuEԃl[^_]Ã\uNjE }; Et @u\ vUEMUċUEڋEЉL$ )ЉUT$D$$Ǎ@oEUĿEUU4$|$T$ AE  Et )S}1<:UE}EэLUM<'t% w~U<'uۋEM\$D$ $}aE}<]]t,E4$D$A 1U$эt1 ][E؋U܍M؉EUEU)؉L$ ډD$$T$@w0EUE؉U6+ẺEu UWVS1,EEE1уM$€` Ш<>'€\ Шu["tVb w] ;u}t 1щ $\$$ Ã,[^_]E vEUME؋EU);L$ T$D$$1@wOE؋U܉EUY Y$t$1U.y$<$6,[^_]Åt$$;UVSUt:u 1[^]ËE $1D$RCt$$[^]UVSUt:u 1[^]ËE $1D$ׄt$S$w[^]U1WS]щ $Tۉljtt\tt u[_]ÃU1WVS,EE]у L E $ljt2<< Шtwu,[^_]ËEU\$E؋EU)؍U$T$ D$@w*U܋E؉UEuZ҉uUWV1S,EEэD1 $ED$E4$;t=,uO€ Шttw uE,[^_]ËEU|$E؋EU)U$T$ D$@w*U܋E؉UEuN҉uv؉t$$xUWVS,];u!$߫E@E,[^_]EE1߹у4 L  $蜫E9sw9rE,[^_]ËEUE؉U)؍U\$T$ D$$@w*U܋E؉UEup҉uUWVS E"_34$4$G?Hu܋E [^_]UWVS1ۃe)čD$Et Xt;uE @E uMt;tD}t&_34$24$+?uEUT$$wee[^_]ËE UT$$Uee[^_]A$D$$D$yƍ@wUBSt$\$E$U24U1WVS=\$Ѓ D$E$:U9s9.=\$Ѓ D$E$Tu~9vӐ9.Et$=U$Ѓ D$TumE9s~E1щ $\$sU1щ $ڥt$$UEUEUWV1SӃ<}t8>… Шu;u*1щ $qt$$Z<[^_]E\$D$$ {Et$D$$zE؃EUEԉUUԉ$vẺẺE܋E$E$1эQU؉ $蟤EEÍED$ E؉$D$E܉D$Ủ$HE$6ډ<$r<[^_]1Uԉ<;].>Eԃ=<Ѓ D$UԉT$EЉ$RtEԉ<$tt]؅.<[ .=Ѓ D$EԉD$EЉ$2RtNjEԋ<$tUԉ<11;].f=Ѓ D$EԉD$EЉ$Qt뜋]؅ Uԉ<.!Eԃ=<Ѓ D$UԉT$EЉ$QtUԉ<' >EUMEЉUM)؍MT$L$ D$$@w\EUEU\$Mԋ4$D$M|{E m.{kҍv] Y<$Uk Aw' 1'uހ U؋M܋EЉUM)؍M؉T$L$ D$$@EUE؉U뎀|(ICUEE D$X D$h $h D$ K]z3iUMEЉUM)؍MT$L$ D$$[@EUcCUEE $_ D$]yU1l[^_]UW1VSLUEEEEt>U܅\Mt0`!?uƒL[^_]Ã`$+"mvċUMEUMč)؍MT$L$ D$$+@wHEUUMEUȉM̍)؍MT$L$ D$$@;E^EUMEЋEU)؍L$ T$D$$@wEЋUԃEUEEȋUD<(<{ Ш.CE|(t4UD$$k]fL[^_]ÍUD$ D$X D$h $h h]UWVSӃLEEE{8tv1߉1}уM؉;уMtHMԅU83'{"w3u1L[^_]ËUME)UM3MD$T$L$ $@KEUEU띃\u3tOvEUMEȋE؉U)3L$ T$D$${@EȋU떍3MԉT$L$$#EE3<'us 33UME)UMč;MD$T$L$ $@w5EUĉEU ;1'.t=vݍt&뒅t҅ҍt&T3PU؉؉4$h35UWVSlEEEUЋMԋ1u< эLMt M9REM {E 8oExtEx=EXM9LEytEyEE׋E8t2Eȅƒ\ Ш`EEąu1}tTAD$D$l $^UԉT$M$L$il)M1++UEBEPMЉ؉9l[^_]EyEyωуMM EEEEUMẺUUԉM)MT$L$ D$$@EUEUEU:Et M :EM:`'ƒ" ШO'MSUEE ˄<'<E UEԋMT$L$$RUEED$ ML$E D$U$UE}EԋUL$T$$5 Mm|9.`GUEE$_ D$E}D36UMẺUUԉM)MT$L$ D$$Y@q $ŰE3w(U 1'uۀ߃E؋U܍M؉EUE̋U)؉L$ ډD$$T$@wyEUE؉U1}уM1} уMB$ȑËED$EЋEԋUԉ$T$EyӍvEԋUL$T$$g)MT$L$ D$$n@w2EUĉEU >1'.tvݐ땅tՅҍt&|x$U]L[^_]UWVS,UED$$轆1щ $ t$$<='$ D$[4$lEuW\$4$!tm4$Dtgt$h4$`1҅tGu@u,[^_]D$D$l $6t$$at$4$,[1^_]D$ E\$4$D$芢D$[4$)}tu\$4$*(MPɉUtx(t[Et }?}1щ $膌}|$$lÅw\$4$< D$)$tEED$ D$X D$$h UEVD$~<$t~uE}1щ $̋UT$$1҉$/<$)D$<$蟋U1҉E]8UE]'U1WVSLEE}}уMԉ1E 9EqE]܅t;} EL1[^_]ËU:\tSM:'€" Ш'uCEEG;E .U:\uE;} mE؃L[^_]É<$UԋEvv̋UMEԉUȋUM)MT$L$ D$$@wCEȋŨEU냋Et$L$$+E;} ETF;} B .EUMEUċEԋU)L$ D$$T$3@wEU]U1WVS,EE}1E E9ljMu܋U :t#;} E|j,[^_]Ã\t|'ƒ" Шt<'unUEE:<'udU :;} b,1[^_]E׃<$U؋E ;} )>t&w%E 1'u׀߃뿋UE؍M)؋u}T$L$ D$$@wHu}랋UE؍M)]uT$L$ D$$]@w]uVRҍvUWV1S1ۃLEEU<2EEEL<)у}܉ $'E؋E8 >tfEԅt|U1"uEtE̅U\EU؃0 >uE؀UE؉:L[^_]À\EЅt1`!EЋE؈ G`t<$"vE.tu @J;U؃`EEUMEUċE܍>L$ $)ЉT$D$@w@UċEUEM؃0 uEt҉uD><(<{ Ш.GEE|>(UD$$HE$D>U؈tS1}؃uEUE<uE $xࡈtL>E뗍UD$ D$X D$h $h KUWVSlEEU uӉE1}EEELMtE؅t#E؃l[^_]Ã\Eԅt$1`!E# 랃`'ƒ" Ш'VUЉ$> [vUME)؉UMčMD$T$L$ $@c ELUME)؉UMMD$T$L$ $@wEUEUE$8EUMEEЉU)؍L$ T$D$$@$EUzEUoEE߄<'uw  UME)UM>MD$T$L$ $@EUEU >1'.tvݍ댋UL$$7mD<(<{ ШtύCE܀<tq|(t?U܉D$$L]܀<.XZאUU܉D$ D$X D$h $h >UWVSLEuUE8Iu1EE1EE1QUȉ $mEEЀ>t|UEMUč>EUL$ EȉT$$D$Í@UMĉUM > €  ШuEUЈ Em<>uMЋEE1U :tFD$Mԉ $[E 8 €  Шu uvU :u1L[^_]ËEt UE.tދMӃ.3EE\$M$L$1])]Ȁ<>9U :EEtMԉ|$L$E$g9lj1}tU:t$|$E$.É$fỦ$T$蘄Ẻ$yE9}19utMM܋E1}t G;EE1}t 9}E<0tiU :t\D$Mԉ $躻t7]؅uE 8 €  Шu u뵡E$U :M1}t*M;M |"UD < <  Ш/EE܋UtMU EtU܋EE̅t M̋u ẼL[^_]É $+$'_ M̋$T$MỦM܃MD$MЉ $覺*E؍wtqU2.D$Mԉ $r.E 0 €  Шu .D$MЉ $/.U2uEE$'_  M̉L$$=EEUWV1SEUr< Z t $ T=F= ЃP`$ H Xu , H uD$$&\s\H |^u]D|8 u|8)DžߋD:D=pD$$GD$D$D$~+D$D$0m  $9d $9`5   u 0 E[ D$$!Tud1҃TtMTtDTu `lr$l}$Ïlѡ $%9d $ d9$ $9` $`9$PD$h p D$E$-p D$$@UWVSà } <@t<*tw$u. 1[^_]À{u1}t]ERD$[$X.tP@to.t*ux]1t{1st [^_]ËEt E.PEx]uJUW1VSU@€* Шt ~E 4$蘿tED$4$D$@M1<@<* t y]D$D$4${UE [^_]É4$t @uurE1tAEtJE$|U뱀*瀁ǁ [^_]ËEU{EU뷋U D$D$C$KU닍xC瀁ǂ UWV}1SEE] @v(Ӄ|$ \$D$$uЃ[^_]UWVSlE] ۉEt U :EЃMt M9#E}1UэyD:$rUԅ҉E}ED$U܉$ML$E$E܃l[^_]$@yr@EEE8ExHEu7>} … ШU :PkM ED$L$$GEt$D$E$GẼEUM}EȉUĉM}<1E$iE$^E$Stk}U)E9|@9}\$M܉ $qE܅UԅEu Eu9u~}rFEx~1M9r`M؋E؃ME,}~1M9r@uЋE؃9s\$U܉$pE܉t$EEE1=Ѓ D$UEȉD$M $EẼ9EvU1UoEx1}уMEyEy1}уMUMT$L$EЉ$U EԉD$UT$EE؉$MM#|$t$EE؉$}E$ EUD$T$MЉ $닋UȋE1RjE̅E.YMȋEU=UL$Ѓ D$U$\yMUEȉMyMME:MЅEEEUEUUtf}̋E9|\EEEȉE=UȋMЉU D$ED$U$EMȉ;}}EŨEE9Um1MM1ML$ED$U܉$ML$EE9]9]E؋ME܃l[^_]ËE؃9UMĿỦEEtE؃9lEUMȉUċMEEEEvEMȋUMċEUly EtPD$D$$ ɉt!tƀtuuD$$D$$D$$D$/U]U1VSu] t*N1t\$L$$w[^]û'_ UV1SÃ$D$C$4$D$$ƅu؃[^]UVSEU t8u 1[^]#A.t4$Qۉ.tՃ[^]UWVSÃLHt@€* Шug t{uy!vgM܅u܀>}111{u&ƉL؉[^_]$j s4$;E4$D$ED$艼t@u ~11҅K1ts}<@<* Шt ]E<$D$QCU1 Kυ}?tt1эAE왉ÉփL؉[^_]ÍE4$D$*`twUE$T$&EE܅6E܀8*1x1x1}1у4$et P1߹щ $h\$$$D$$4Et $}E܉4$t$蔖xE܅YE܀8M1x>t6$1(E܅&}܀?1+}܅.~E܉$L[^_]ÀD$D$@$胦E(E܅oU܀:c1z $1Kl$T$iE|]EoƉ$t$i̲빡 Etlj$|$`i111EeE܅.tU܀:t1z1z1Ex}X@4$ ?EÉD$T$4$+1ҀF VÉE$w>11E܅v.tu܀>t}11w11у_<$UWVS UEEEEE]]EUD$$.h @]M9ˉEA99 Eˉttڃt:Ct/UA U2#wE!F< <}O5 "E#<@ Mt]E|} E 1ۃ}],0< cEtEUET$M L$}<$U>U|$|1Et |8x t1t}E]MEɉ|1EUD$E܉D$M $|El|%}lhd1EE}U111ۃPt1(? )12 U u]`;:dDž`$<EGMƉL$$?EЉUԉ4$輼E4 lDžXDž\llX#\UԋEЅJ;\| ;Xly`T`1`щ $ b`L$$$<6$`G:E4$D$>EȉỦ4$虻E ŰEȅ lt2EU;\ ;XX\UȉM̃lll1ۉߋMx $Mt }<$|t|$ٺx [^_]Ë}}#€? Ш@.*vE$UE8U|$)ML$} <$UE;Et-nt%t t#>]ۉU|:… Шj|9>ZE}1ED$ED$U$|Et#?E8%ƒ Шt}$1U<-fY4&t$| $}<$۸|uE$QUU2z1}t+t-ƒt? Ш5t#(Uz1}/t!t$8h L$ Dž|E}<})U2}  ,Eɉtd]E4-h $ݮ‹ED$$P0Et M $袵|t|<$芵E$ [^_]D$U$UE}MEE<}ZX]N}<!#€? Шe@.[*ME<}.EUzE1} t M ].}~E|}|]]$61щ $gZ\$$PxED$D$x$ʪt$M<@<* Шt y]x$3E0#L}U.|Ept?tt=1Tt+Et }<$[M $P}<}D$E$YtEP@E 8X}t]7<#t&:1^D<*<@ Ш}ODPu _E1۾ ljщ $|X T$$_xlj؋xD$aD$D$Ɖ$r~ËME|*v}$|$P‰|1} t E Ut U4$赱$譱x $蟱E}| [^_]ËUT$M $|E:&}x<$ZEt E$H|.`|$M膰EUčMHLPU)؉L$ ډD$$T$裭@VHL$3NDž|D$D$Sh $虩|$$+_U1:.V?6DGxD$$9 f|t|$t=Dž|1}t?Nt+t\E1} t M ]t }ED$ U T$ML$t$UE#(|U$ y'诮-UMċP@UD)؍MT$L$ D$$̫@@DEUt}w jU$&-}t M $訮|t|<$萮E$腮l5 t+E1} t E Et U|t| $ EDž|.}|$ E D$U$+T$UEv&M| $_dATQX\,1E0vV^ӐYʬvdd?DžXDž\<$XDž\D$D$\m $UT$$w'M $Ь}<$A$IIl,/XEU<~D$~M $tUV N2}1щ $ERUT$$+D$$ۉt$4$ٔÅD$M$4C L$n&t$ƫ4$E$賫}.,U$蜫DžXs$联|d.tӋd8tDžXDž\xDžXDž\x1dуXX\EЉUD$D$ph $}|$$]%X\EȉU`TB RX\juЋ}19yÉ19}19u1tq9}19u勅U:*Eu\$Ԓ9t<$}EƉ1ۅ.$訡É4$蟩赤$t&VUMЋ}ȅ҉<84EEDž0xtxft<1эyҋ8>u00<0  vˋUM(<,0+0MT$L$ D$$:@(,EUeD$$qN%<40+8t|tttw<<݋EUM $<)؉L$ ډD$$T$臤@Y $EU떉\$0L$<<$lۉu EEq1ۅ.G4$R0lM9#'_ 0E4$pۉuE>t$.<$ޞE<$֦}}—1t'E\$4$D$o<$z؅.tEj1\ED$hT$EȋỦT$D$ EЋUԉT$D$E܋@$轏\EȉD$EЉD$E$D$}<$(L4$EXED$D$U$E8$贊1."M|$4$L$؋jE$yE0<)IEML$x<$萟|E8@}E1} t E E.TUF$tEuE:4$$辍UWVS\EȉUċ2Mȋ}VUԉ\Ã!Zw$k UUЋ}ԋE0t%跥ӋPu_uE0u;u}9$NJE$@} t E uԋMĉ1E\[^_]ËUMȉt$T$ $E.t8u $ۣ뚋U$@PHD$D$@$>Ey8t EvM $`EE$Uu7 :E t E  EUȀ<2Mĉuԉ1EU|$D$$EȍU=E.=.U.M9yEt ErU$耢uE[MȍEЉUЉ $D$護uкEu$<諗EME $D$ %ËE։$U$E̅ J =lΒt EtMt UM$L$E$uui Ë…EEE..E8t EU$)Eud=EvME1ZE$t&ЉEM $EE$賠UUEЋMȉUЉD$ $uЅEut 8(EEԋMăD$D$Eȉ$tEEt E$=UuԉUl$L$iHE藑$T$HH݋ EM $BE$˟  lt $豙*UMT$ $^$EE$]ى$E= l5+$t$}GU$M9.Ev $$͇vM$L$15E1}E$躘Ej1Eljىщ $DUT$$tEىUуMMЀ< )u0ME$<蓓UE$$ 5 UWVSfDžhEUEEEp$pCEEEEEEEE|1}} уMt U EUMÃ'"$&Eu}.À}<tBELE̋UȍH9|$9}EȉD$E$!CEE̋UẼEEUMÃ'6E.uEE4UU1EэLL<'t)|}<'u׉\$ED$E$M<փ}]-E:t$譛11}B 4$袕Ɖ<$yJ>t<PBME<(\ER5 D@d?t 1<$\ `BUĉEEt }D$$_ UE*|ƋE@ED$EĉD$U$nt4$>EM<tE.1>]t%~ft~ft1эyEȋU)9-:‍EȉD$E$9@ỦÍ|$t$$ƗEE4$蒙]7UUԘ"ƅhhfhE̋UȍH9|$9}EȉD$U$?EEh} 8ŰhBEňD:ẼEE]$ٓ d4+d\4$D$@D$9$ >T/dev@/fd/@E؉T$D$ D$4$o@D$T$R9ULM)؋u}T$L$ D$$贔@w u}Ӑ*vEMU)‹uЉȍMЋ}ԉL$ D$T$$NÍ@uЉ}ԻC$=1ɉE}PU89r.EZBUEE$E詵}E.G>04$B4$ٖEED$D$$=E=$iEJE.Et$} Et M ut }].E+UuD$$~UƉ$$jM9Muƒ} Ш>}G<$@D$É$AEEKE<vBEԔvE}<$n;ƋUEF^Ut }UEBU D$ED$ED$ ED$ML$}<$E,=c=XE .EM }}| EEUu E@u0EtÅ ;BExEMU)‹uЉȍMЋ}ԉL$ D$T$$ِÍ@wLuЉ}ԻC$:1ɉE}PU8D9rDPu뷉4$t&诓BELƅhhEfhEE}<^R4$yML$4$"EEƅh\냋MA81щ $ 9}W$T$<$f>u ~L| EЍ${=9~FD$$8D$£)؉$D$茒2TH   `X, H $F0D$$ovo0XۉH {3$!1` er\ $TE@ME1Ʌt 1VD$Ȁ9ue D$}<${E]t EtEM $E[^_]ËU$,;D$É$D$D$m $5\$T$T$0 $賌;\t\ $ml >t$dl 4$I0D$D$h <$_v$USÃED$E D$E$=t=t[]=lI[]Ut8u1ÉEE ED$E$D$E_UWVSà UD$~$oD$$118t%UtD$$bƉ$蔋4$rt4$_t<$D$AÉ<$d߃ [^_]1߹щ $]1\$$FgU1WVS<ҋ]yE D$ED$E $1KEU;/P1щ $0\$$踌E EEtM@Ut<\/}t M1t U4$跆=Eu C$o}ƅt$M1} ut E$uZ}-ƒ}+ Шud1щ $J,t$$3É$节lj$U$vt}E|$$}<$[^_]ÉڸV ؒD$1EU D$$cD$$+zU|$$oE t EvuO1$9nUE$ѣ4$./$6+$"+@UEU D$D$$.UEU D$D$$t;1UVSU ED$D$$蝾Ɖ$^Xt [^]1[^]UWVSÃt8u 1[^_]E1߹щ $*\$$EED$D$$ ËEu ؃[^_]É$訃USEU t8u1[]Gt@u []ËlUWVS ]t8u 1[^_]D$~$fuR1҉D$D$$P1t E uX菀$kƉ$V [^_]Ë~mtD$$(Nj$蓂;y$jkD$lj$8Ɖ<$hUWS ]t;u 1 [_]E1߹щ $G(\$$0ED$D$$EU =t3=t,EutGu7p [_]É$譁ۉ$,D$$->kvUWVSÍE,uD$$tz1ى $\'E$@\$$6UD$D$D$ D$D$4$9É<$,[^_]É$qE$t$D$zËE1.t;t $xÃ,[^_]ËEU1ۉ$T$4r.t8tuS<$Rx\_$谳1ۅ.LPtHuuo,1ۉ[^_]É$!zD$D$@$dÅ5$yAUWVS }<$7tupxƉ$ED$E $肯1t;1,0< vB{u  u>1҅‰<$$E [^_]É${닉$vtUWVSLU1҅H$EE=1=UB@tӋt B@u;UtM׉ 1tO ( tCt;5 Ӊ֋tB@uۉыu5E䣄>tdËC$觘u* lu = uu$Q1҃L[^_]ËE䣄Et85 1}t uEE>M؉M}E_SEċ3Ѓ>~UEMT$1҉L$$=r=gEt G@4${t 3gMȉމL$4$X}ĉEȅT]t E$PMȅtEȋEȋUȅ҉UE , EEEC @ Mu$N1CC$xƋC$|CU0]M $3F]EuEt E$O}tE0"EUUEt?t6]$OUL[^_]É$MȉƉL$4$}ąE._SEċ3Ѓ t V  uV t;_D$4$ !4$z_4$N>~_tD$뺋E؉u؉uԅnUD${F$8^tϋF$yEE3E؉D$UЉ$W&M̋UE؋$/zEM̋E$%~EЋ8uT$$gruGMЉA듉$LRC$օuQuϡ$GE$MUȉ$MltXTEvEU$3yM܉u܋uԅ]܅t U܉$"MM؅.E؋2E؋M؉MzC$ 2E =%U11tXU$#H|$$$MNjuمt(E<$D$ UE]_uBM 3$CLYC$tƋC$xC0MHE] lu  u~$'E؍t&$EQD$D$h $pS$T$$<6UE]&UE]UE]Ut$@US]$v][]vUuD$;$US t u1[]ÉD$ED$$8ø.t׋CuC$Uv$Mv빉$SUWVS  D$ED$$aƋ@tb$u^1} щ $U T$$w}^U ЃC:/tCEF [^_]1}щ $UT$$wF$ÉFlC0UWVS }t u 1҃[^_]D$D$<$1҅.tۋ@0@tgu;.u {/1߹у $.@/Ǎ@\$$v<$ru<$t>.t.1щ $t$$v[^_]D$/4$r.tD$ D$t$$ h1҅/t1߹щ $#\$$ vBUVS]$ ۉu@$1҉^F 9|[^]U1UtB]U1WVS,UUB$vMQEE}M]1ɉ]1m$={Ɖ}1щ $ST$$uSF1t E tl$U FC F CۉFtu$E댋EMP]} ]9;UMBAȃ,[^_]É1щ ${ST$$atpU1ɉUiɓ1u]UE$‹E @Ƀ!UWVS ] EuE HU$M yƃ!Njt 9s tQu1Etj$M ËE s CCAUS؃ [^_]ËMS8uL$$iuC1 [^_]UWVS} t E pu 1[^_]ËU1$M ƋAU!E.t9s tߋMS8uL$$9iu݅tE h듋UMUWVS } EtRE$4_$!q AE AAG [^_]D$|$E$.t [^_]$mUWVS M} EPPE~tM4>u!QC$׋C$o$ot*6uًC$oC$~o$vou֋EPM9ʉME@ [^_]US]$0o][]#oUWVS }t<_t5W1~+t 9~t$U xuW9Ճ [^_]ÐUWVS$=^ ϢtE$D$N u 1[^_]ËE.x$xjMU1 t+9| 9r[^_]U$4jUSÃtED$$Fu&Uȋ E؉AEA EĉQAt[]á@ @@@t[]UWVS1ہU$=9E}259}#M8uL$$euډxNED$E$Fu U EЉA EȉAEQAU$mČ[^_]É|D$$[$ãUM1҉ t$}щ $UT$$nC|UČ[^_]U1҉S9}, 9@ @@@|[]US1ۃ;}8$l@u9$k;|ȡu*[]É$k뷉$k[]UWSCu=h 1у $f@l/var@/mai@ /áh D$C $Qm[_]UWVS E$G^ <E<$D$otg1ـ; 1t_9tZu<\tQu]u91D$ $i_.$b4$Gh5 uZpD$$@uϋ.|9tD$D$m $`\$$e|D$D$n $`[$,n \[^_]Ã+DžD$D$.n $R`4 $ D$gUL H D @` K @` K@~D$$# D$$#  D$$t#h D$$_# D$$D#l D$$/#  uD$$ # D$$" UECw ` uD$D$p $y^UWVES,D$E$tUE,[^_]Ë} EEEE}}E` EԅtStL%Dߋ41щ $S4L$$6_0Dl!lh!蛍tI8H` dD$D$@$:>tD$$@T[^_]ÍHD$$@D$D$$@W 4 $[D$D@0D$T$ $kEUp ]UWVS,#l @ t鍅h$rZ$dZht$$W$D$hD$X^@v =KD$D$4q $S@t$$T$[@ D$D$$tW@l,[^_]Ë@1щ $B@T$$$\$D$D$Uf C$躊$YG4$AD$D$hq $R\$t$$]lQ$t$Z"UVS]@U@tJtERS0 tt= tHu=S0[^]D$D$p $R\$$[^]R뼉d!D$$#PU1ɉt@utɉúq A ҉1tҡdtɉ `D$$@HPUt@ut]úq B]USt@ut[]ú&q ClUlUS]` $D$6$[]US]` $D$ 1$[]UVStb<@t^$փ@~ޡ t 5 u%t  u%t u%[^]ètD$$U1%@YUZ]4UZ]&UUt+@u't>~$A&t@BtK$1Åҍt&ut&t&t&t&UE]UE]UE]@UE] ` ÐUS]9tuV$ND$D$$gW!t O8t[]1ҍB[]USۋMƒ кuCʣ[]USD$$vڋ  9|[]U=Et u 1]ã]1U=Ut u 9 t1]9u]UStQEtG1ҋC +C uCC [1]D$ D$ډT$$Pǃ[]UWVES}D$$|$UD$ D$D$<$PxUE|~u uf4$$E;=}<;sECC1C C؁Č[^_]É = vv|<$K1UD$E$9Qx E1UVS]tC3u$R[^]É$RU1WVS]u 99މ;=E<1҉Et)$[D$ÉD$<$ڡMt2}ttbH[^_]É;k=Ef95ZEN$L4$USEt$][]I1[]UEx+;} u EItUK UVSuu^] tfup=p!95 D$D$$N؃[^]É4$.] uD$ D$4$N{D$D$q $nI\$$$Z=X$!4$95 I >D$D$4$Nt 2D$D$q $Ht$$US]$t&~*D$$h[]Ã1[]u$U SU ][]USSC 9tu=CD$CD$$d~6C CCC[]ËC BC[]ËCC u KǃKUMtPu]ÃP@ ]US]$ZU T$ \$D$D$ dtqc$y[]ÐUSML$$Љ[]UE UEe]UE$D$UUu]E:f]U ɋUu]Ef]^Uu$1Ҹe:Uu$1ҸGgUҋEt'_ u1Ee]]U$UPU PËU҉tU]L]UEt( tD$$ uUVSu Cu S8t$MLuՃ[^]Ét$$Du։][^]LUEP@D$T$ $JUVSut S8tT$Kt;Ct=ft C$S΋KC SD$T$ $I볃[^]Ét$$Cu][^]mKUE E]\UWVS E }0F$Uá{s CfCt$|$$1I [^_]UE U$^gÐU1WVS,EE]EэLMt%?tf(!tRF>u(>u,1[^_]Ã[>@vt"IwC럃*t +u<(u,[^_]Ã\.t]uE.uËEUu)؋}T$ D$\$$F@wu}녃E|n\eU1WVS ]u щ $t>u{u M11Ʉt>8 t#ut| /.t8\ u [^_]U1WVS,EE]у L E $ljt;!u\Hwu,[^_]ËEU\$E؋EU)؍U$T$ D$E@w*U܋E؉UEuQ҉uU| ]UWVS u>.tO !t9x t |$t$$ou0 u [^_]ÿFt <.u~u 1[^_]UWVS | utV1ۃ><D$$46UD$D$ s $B71USÃD$D$s $7{UWVSÃLUtk Шu"=€! Шt{=ta-t!1[]À{u[]À{u[]SҐtր{uЀtt:KetR1eultgu[]À{u[]ÃnCl.t~҃nw҃f.t1q.t[]U1U:-t]BG3w$s 1]ø]UWVSӍU}x9(xAtI&t]1ҁ[^_]1҃.t덕(y1҃.t҃u19|u‹p9E}[^_]Ë]M(,111 u]MEU11 uf[^_]ÅT19Hp9E9UWVSÃ,E t&}$|$谽ME1ɉUuH,[^_]ÍE$D$>3E؉4$D$'#1}w‹E$t |$4$MU܋UE1tыuMܸ9΋]U|9s1yEUM؋]11 \EUM؋]11 ?uMܸ9΋]U&91&uMܸ9΋]Uo91uMܸ9΋]U?91U=$D$у L$赍Uu ÅUWVSE }UE]UE =tps>€< Шt,u&>ED$U$1[^_]À!tUC€< Шu;!-u {D$D$;s $/{uD$ DD$$D$@[^_]Ct<=o{t&]{=&v{f덉$t&OvpUWVSE@G3w$t 1ҁČ[^_]ËE 8ЁČ[^_]D$E $/D$UE 1u EtfČ[^_]ÍED$E $y1҅p}EU1Dž|1 {|?UE 1~uUE.|;xD$2UE 1CTE%=.<;UE UE 1E%=@뼍UE 1E%= 똍UE 1E%=`qUE 1E%=JUE 1k|E9\ 'UE 1HYE9EMfDUE 1/E9d UE 1 EE 18ED$E $D$1E%=zUE 1EUE 1҅.(E%=… ƒ E $El E 8><$vO2rDž|cUWVS@5H<<$1҅t+tt/C;D}pC@DD$<$:ƒ[^_]ÍS;D@}1ED$$.1҅t͡@H@DD$jo 렣@UWVS @5D9}_=H8!uVxuP1ɍSӍR9@}7)ȉD8!uxtمt [^_]v8(tDC9D$8-1ɀ8C@ȃ [^_]Àxu9@.}u@H8)uxt]D$D$Xs $6) @Hxm$t'hrZȉ@OD$D$os D$D$s $(1USM@;D} H8-t؃[]ÀxauxuB@…!US@;D} H8-t؃[]ÀxouxuB@ UD9@}US@ HE@DELw`$u <À8[uxumM8]u xD$D$s ;@H8!tma¡D9@D$D$s $2%18¡D@밡H1ҋ@81ހxuB;D@}G1҅s}<D$$z#1<3U(=`uD, tBD$0 D$4 D$8 D$ v D$ D$ $`*`á0 D$4 D$8 D$v D$ D$ $`)`US]YD$8 D$$#v (u[]D$D$u $#E[](Ut$sU1t"ET$D$$.1҅tPU1tE$1҅tPUWVS Eu ɉEW$ Ë}1щ $UT$$+1щ $t$$+CC1D1 ƒ  Ш}1щ $WUT$$=+D$$T$nXE\ [^_]٩U$. @$(1щ $t$$*SCU1SD1 ƒ  Шt MUS[^_]CUS]C$T($J(][]=(UStTED$T$$նøt2C$C$'$'$\ 跨@[]UuÉ$D$K讷$[$\ eUSEE )‰u L$$[]UWVSt@u 1[^_]Í11$9 ƋA~7Mt&9~"tBuMA9̅t$4$D$ -D$D$4$]#[^_]UWSE$01t,CE1}щ $ST$$l([_]USt <\t 9u[]ÃU1WVS<}щM $#EE$UEEEM1EEUEƀ< 1E<0tpuE 0 €  Шt E΀\'€" ШJEԅut $>v D$ t 9u1}+}YD;E| UT29ЉU}MT$ $pEE]|$E$D$i%;1ۅZU20 ]EE؋U tb 1 tP$Ev D$0u9M<\Z<'<" Шu먉ڋEËE<u߉])uM؀<t EEU|$$D$$M9D$\ $!E؋E8E؅u=U$H@EЉ1}эYэqD3;E| UT29ЉU}MT$ $EEЉD$E$M%u؅1tUD< <  Шu trEiX1}})YB;E| ML 29ȉM}EL$$0EE]|$$D$*#;$>v D$8U\2#DPuaU<2U$'"E<[^_]ÉEM<.\H#DP1E(US]tCu][]![]É$!][]!UVSut>FP Z $ڋF9u@@ FFF F[^]US]t $C$N][]![]UWVS u}t,VF t FX 9|$$U x[ 9^u [^_]UWVS}G G E … Ш_1C 9ÉEI 91;u u9t{A@ GH GA_9tE EUEU)QI 9uE )G W)GEWE>t UR $U/Mu1[^_]Eu?MA 9uA GGGG G@@ E볉<$UED$D$$UWVS }tCOt\$$'MQ]Mv 9u]E[^_]UWV1S9։U}1EEMFU E1}UэyUD9|9}E\$$ӾEEUET$$PE }1}usF ;EtEUET$$EEF ;EFEt UEE[^_]$@@E$E%E$U1WVS Mu ]t3QA tQB ] u [^_]${ [^_]UWVSMYt QA u 1[^_]É $qNj@X 9 s[ 9_t3ED$ ED$E D$C$IƋCt̉$E uXE@t@P1҅tEUED$D$<$<$S[^_]D$D$e ҉<$UWVSMu }Yۉ]tbA A tZQA9|P~J[ 9]tFS9|9r119]t,19];M|";Ust[ 9s1[^_]1uutE u&E U EET$$ډ[^_]O1҅tUUWVS\EtMQA u \1[^_]E$v(ƋUBH 9ȉMED$ D$MQ$T$7UEEB}Et/}E t"}E t}1уMEąUĀ:znz1UэDD;E|e;E}M4$L$3[ED$$^Et.U:t&zz 1э\3]3=EątAUčT$$MĀ9t'yy}1э\UMB9A t3 Eąt Eĉ$UMR U9QE{;}|E;}}E4$D$3)>} uZ\[^_]É$ E5E\EAEs4$t&KEĉ4$uĉ뉐UWVS]stt$ D$D$$rCu.C{C Cu6CC[^_]É$aC{C Ctʉ$ACCC[^_]UVSu D$4$D@uN@u@tuE$D$GƋCt>E Ut$D$T$ $St4$[^]É4$@[^]Ét$ E UT$D$C$O뻉$|4$FmUS]$Dt9U uPt[]ËPu&@t1[]É$>[]É$dF̉$虏1t&UW1V1SE] @E!t$|$ CD$E$҃t(EPuыCt$|$D$ E$`̋E[^_]UWVS,EEE] <1эqE"Utm[tr])DžtY}v؋EUt$EEU؍U$T$ D$ @w,EUUEUu,[^_]Ã딅.t)kUWVS } u|$F$t%D$$O> D$_ ] [^_]`cv uLv D$$O> D$, [^_]UVSuD$[4$1҅t4$}1[u [^]D$$e<]ƒ 1Ҩuй9} < <  Шt 9|1먺UVS ] $覴ƍCD$E4$D$DD$4$fÍED$$CEU$54$-Mt EU [^]l$UVS] uD$$f<]… Шud <@<* Шt{t;A$D$xrD$T$F$t$1[^]Ë$l< D$$D$`\$D$ $hv D$믡< D$$D$"\$D$$rv tUWVSLE E E܀8(MD${v D$ $蘄E Cttt<[uD$=C$4tŋC81эL $jEẺƋC8*Eȅu[€] Шt \1=uEߋU$EL[^_]Ë]M $茔EE$U 9Ut M܉ $ E@Et$UEEU.tMA@8t ?[]ЋuԋU}Bt M܋EL$$ AUNjBt4\$t$ |$$Ѕt<$ EUEExM|$ \$t$ $E D$<$EE؀<]tZE|$$~@UNjBtMԋUЉ|$L$ MT$ $eUԋEЉ|$ T$UD$$:E|=u}toG<@<* Шt}tM؍GL$$҉Éx;EЋE؉Uԍ|EU ED$$E<$ C$ CỦD$D$v $|$$-US] D$E$t] E[]g1[]UWVSD$[E$+EED$U$ƋE9} }<7]t1E$(u tU ]t }1[^_]1}щ $ӮUT$$ [M t} U.t+uU2[^_]Ë} .tU UVSE ]D$ED$$1tUM<@<* ШuFE~D $D${щ…x0E T$L$D$ 4$É4$؃ [^]Ày]u4$$ 1[^]UVSED$E D$E$T1t $ ;$tFt1[^]UWVSEEU} D$ED$E$u1ɅtMM<@<* ШuAtt$ $x1ɅtC uK[^_]Ày]utE1Ʌ.tCuiC$苲D$$輲NjE8*uEuVE<$D$Ɖ<$[^_]ÉD$T$C$Ɖ݋C$G1ɅuM<$;É$OƉ$&띅t$F1u4$4E@u4$ E1@[UMEU EM ]NUM UEU M1]4UWVES} D$ED$E$t]<@<* Шu 1[^_]À{]uAuN$h8 D$$MƋE8*uu5|$4$|lj4$%[^_]ËA$1u뉉4$É$lj$UWVS 1[^_]UWVS 8 4 5=UE$  <4 8 6U4 U5=8  [^_]ÐUVS] u~|[ty(1t|(t81҃[^]À|{uр|$uʍDD$}$u뫍DD$)$u멍DD$]$ueU$^ <_ %0VXU1"%0}] H UH "]UH $] "%0V$] VUSt$] (*$] D$/$] U$^ *t8ut[]ÍE\$$D$u߉$'x"UVS1ۃp"uu ؃p[^];"~Et$$D$t*"t$$,á"""8uD$D$A4$Dx$xt&렋$XD$D$v $\$t$$膳.UVS1ۃp5"u p[^]$^ (.t8tߍEt$$D$tn+"9} "t4t$$+á""$] "Sk4$m+á""D$D$A4$q$Ht&`U=tÉ$nɐU"$Q"UWVS,D ut =,[^_]""Eny  E.tNj1׹=l хYu |\1щ}щM)MEL $t$UÉT$ MD$v $D$MQ\$$T$S$.&4$,[^_]@#E%|\.SDYE'_ ?U$] K&ud< ɉUMtt <\t <&tu1]ÃI1]UEL ]鑫USn[]U1҅tUWVS"tt U: =T E1V<=1Ѓ D$E<$D$EP DE U9T ~AP Dt D$ D$&$D$dHlu>"~E t4EZ[^_]É<$tk1[^_]ËE$!1ۅtM81t2M8uL$$cu5$Iuΐt&-߹щ $ѕ\$$aL$$_UUS"=M~(t4"u l t(M[]D$ $[]Åɉ.tt< <  Шt .tu.t;#vuUWVS"]u6 t-ڄt$5I =H 8t:8t4uMtH t;u ؃[^_]É$ED$E$:tME t"ƒ Шu?1 uL5"1u]iEG1rED$5 D$ $룃t2E$"t=#tE뤡#uŋE8t$볋E$G: D$h9US]u,D$  u D$$ ;[]D$v $v JUWVS]5d tsd w utc;D t[D$@$K1u1[^_]d _ 닅u;= 1щ $肒 T$$e[^_]Ë= 1щ $G Ë=1ى $#ۉuG‹ t<@t/u$=[^_]Ã@D$G$USt[]$n ` w   D$H  D$D $ w P9D$D$$w 49D$D$$/w 9D$D$$Gw 8D$D$_$;w 8D$D$| $Yw 8D$D$$nw 8D$D$$w 8D$D$$w p8D$D$$w T8D$D$$w 88D$D$$w 8D$D$v$w 8D$D$k$ x 7D$D$6$'x 7D$D$K$9x 7D$D$d$Wx 7D$D$y$ix t7D$D$$x X7D$D$$x <7D$D$t$x  7D$D$$x 7D$D$$x 6D$D$$x 6P D$ D$$]>D$ D$$^>D$ D$$=D$ D$$=E ED$D$ $7=, KE D$D$ $6=,  D$ $i6D$ D$${F=D$ D$$/*=D$ D$$/=E~ED$D$ $]6^=o SD$ D$k$~<D$ D$6$@<D$ D$K$@<D$ D$d$$k<D$ D$y$$O<D$ D$$!3<D$ D$$!<D$ D$t$g;D$ D$$*;D$ D$$g;D$ D$$ ;D$ D$$Fm;D$ D$$vQ;D$ D$$@5;D$ D$$\3D$ D$$*3D$ D$$=3d $y  y 4 WV[]MD$ D$v$9D$ $ ^3D$ $ E3UTFUu1É$$P, 1UWS]uD1щ $)\$$, , <1[_]É$U$ӸD $ D$D $}g贄1UWVS<D$|F $QD$|$$e!Dž1< <  Шu €  Шtu€# Шe#y  ׉މC s t< <  Шt u' €  Шu €  Шu  u҉|$D$$D<$d<[^_],0< w_5 €  ШuC.R €  Шt.*  €  Шuπ €  Шu€# Ш.O €  Шu> €  Шu$ u9)<$\$D$LHƄ9~+҉ HD$$31щ $FT$$)L L DBsU$] t/=$-y uոFy U tUSt/1;L}$@;L|L[]U x%D$)Љ$ , 1USE $D$Ot/%;%|',  , 1[]á%9~ҍC , , 1[]UWVSEP u T$E$E]=T 1у $%t$ËED$Qy D$ $ uD$F tWy $D$ËE |$$E#P k[^_]M $$'_ "&1щ $\t$$EAUEU EE y ]UEU EE y ]UWS IE_EEE$觲t8u 1[_]1щ $‚\$$$ܮ [1_]UE u Dt u1]Ã]UVS1ۃu>$>~ d 1}E Eu >D$4$>uo4$">tXD$4$tB@t;= >u1$ݥ1%>@oD$u4$cX.t[^]Ã}'t~(ttD$4$2$ "91ID$/4$پD$b 4$D$+UWVS,EF] Ex  < <  Шtyx;5  "€' ШtɉMx< <  Шu19 ؅t <`U<`t7]1t p EEE,[^_]Åu@D$_ E D$ $ntD$_  U$T$NtD$+E$iEj$^y D$2& E t&#|1>u{1$19f|v.9DD1    <t"pD$^y t$ $,;E ~؋  D$^y U $T$  E1< <  Шu\$ $D$ey \$D$ $G.9uEt$Et t D$*E$EEu U |$UT$ ED$U T$E$2EE,[^_]ËU:`D$_ U$T$(1!\$U$1<ƒ> Ш1ED$Et$D$ U$T$vD$UWVSt$g Y1=Rt<#1҃<[^_]þ1؋=уM܉=уMщ $zT$$Eljщ $zU؉T$${Ev~}1]Eщ$)*UD$6zƋED$4$U)]܋E܉D$U$}t$8@1$$D$$vtjD$D$$eUE:~.]=1щ $>yT$$!!D$/$e.*D$4$D$E1щ $xt$$4$vY>ŀ =ŀ t!8uӉ|$T$$ u1щ $w\$$D$$%v.<~D$4$D$A4$h5trtf=tZtN.8uЉ|$T$$uD$$w 9‰ӉE5 C;EȉÍRT0tD0t֋=t$ 08u|$T$ $auC[<31щ $Cv T$($os1҅E$ҋE$҅rE؉$UU\$K$b${'_ .=..2t!8uˉ|$T$4$u1щ $ ut$$<[^_]É4$$tf.$4$D$tÉ4$UWVS } ]<`<$1)ߣщ $:t\$$#ã_э|9v$ €  ШIud9wD$$ £1t2t Ztt u=8  1[^_]$^y D$v1  $>sǡtkD$<$D$D$$ [^_]É$<`bb랉$9)G< <  Шt"D$ <${(D$<$rUWVSE u)$1 <{;1׉عщ $q5t$$Eу҉ }<$£>u1[^_]Ë.tt 1ɐUVSE 5$|$D$E)$u(t|$)أ$D$ $B1҃[^]UVS t&$ $+t1[^]?[^]UWVS $趛<$5$1;5|$Es$= 1щ $g T$$D$$t<$`$6$Z<$7Et&|$$1[^_]D[^_];5|$}܉5$ 0< < tD$$'$fpUWVSU@u`  [^_]ÃuC$N=` EUFMt,$Uu ` UMUʋE` u.EtmMU$ѿEuE$迿MA UuM $臿[^_]Ë$t0$҅$TC$EE` t$끋U$q$UBF$VU1WVS ul эyt C9}~ )18t u [^_]Í1$D$.t U$h $xp u1ËE1UStD$E$Pd$ÍED$\$Kt$t[1]É$E%=@t[]UvE 1U1]UE1UWVSEE0D$$4$8pEt$$D$e >.u ~$py #4$ÉD$_|$ |D$$sxq1ы||р|/4$踼xU|$蟼EČ[^_]Å<1щ $bt$$wD$lj$9$)E‹E81}4$E<$$U2D$`4$谟.1D$_ 4$уL$li@ыx򮋅xщ$YL$bx/D|$fT$4$E<$t&/4$'$6a]mUWVS,EEE 2P0\EE1$8tz=BT tST PB9~΍A <$PD$6NjTBT u$EMUMTD$ ~ D$D$$莶M1 8}эq54=tt0th54 t\tU؉t$X0D$8$聶u΋DE 1|щ $i_E,[^_]O,1[^_]á$ePT-UVS=L 5t$ 5[^]$?5[^]UVS5$5[^]Ub ]U?]U$v(UWVS 5=U$ }y  U5= [^_]U$qU?]cUu]U$6hU?]U]U$d:U?]U]U$ U?]UWVS E <L\X9t`:D$E$\ơT 1عщ $\t$$耸\эY $l\t$X$PX*XD;ut4$ X$Co=%<@<t@@ [^_]á@1҃@ [^_]1щ $[t$$誷\X^$胵$v<]$XXU]US= t-4 $t4  4 []T U*]U?]UWVS $} ;|$}  < < ~YD$B$|5$ $\$t$$ t$?u T $K*=\tt|$$k*ƒ\ Шu. [^_]D< < uE$8<$D$D$! [^_]D$\E$kD$E$賱$D$*E$SD$=E$v;U1WVS ]щ $VYۉEu t*t#\tFt&9t7t uE [^_]À'€" Ш.t1ʃ;uE [^_]UWVSE]};~1} 5| 1"'u= 1t0 ">u%D$!$t"l;]&t$E1um1}эY $WNjED$<$軳} 1tDU$舱[^_]þ$́Ek1}эL $iW]Et$<\u9\;t uE$ UU,D$$貔t\D$ $苔$D$V $ME 1L"?D$!$ '$EUWVS \E }ɉE]1t7u8tE}]E [^_] L$$,u؉] ߉щ $UE[^_]頱UWVS\h #91<u9Luy`TE t]\$1щ $*Ut$$D$D$y $袘$;<\1[^_]D$D$z $ç$*<\[^_]Ë`E tO͐UWVSӃ   €  Шt  uEt ""€' Шu1E tE  1 1҃ t u\t"9uvt9u؃ [^_] 넺D$D$y $踦t$|$$dlD$D$Tz $腦t$$5lUWVS`u*1$EED$øE\$4$D$* 1:u:ES$D$NøxJE\$4$D$`T$ D$|$$[ED$D$$ <$1[^_]`D$D$y $St$$kU1VS#t$D$E$D$ É$Ɖ$tu [^]É4$[^]US]<"<' ʀu1$D$?[]ÐU1ɉU щ…u]U1Uu]USM] ɉtʋ‹u[]ÐUWVS1ۃ } ut\8t6߅tGEtD$ t$$t֋D [^_]ÉT$4$@.t߅u [^_]U1҉WE M89Lt<Ѕu1_]Ë1UU ׹щ $PE_]lUWVS1ۃ } utZ8t4߅tEEtD$ t$$tփ [^_]ÉT$4$j.t߅u [^_]UWVS u })G$OuÉ|$t$$=; [^_]U1WV1S,} }уMEEEE1M8tjɉM܋EtEU MU8tS_9|9}Ut$$OEEMEUߋME<uU:,[^_]ÉȋMЋU L$T$$ʥuEt M9}3U MuEt/EE1}Eu9}Et$$NE벃EUWVSMut E8E1])ˉ$-NEtatZ;E \+}}9|9}E\$$BNE}}tuE[^_]Ex^ExM1уM4UtGE+}}uVEE9|9}E\$$ME}E}D$<$$}VF;E  E$uED$\$S.tE$]E1}EуȉM9|9}E\$$ME}E}D$<$肨E}$dUVM Suɋ]xt< uyD [^] < <  Ш.tUU EE U]&UWD$'_ $號£du&D$z $;8 躡$;8 莣_]1щ $KdT$$蠧dD$z $;8 g$;8 ;_]Upt#8tt8utt8udËE$HUWVSE]tE8ut1[^_]$!^ tztsCthPht 8EEU9U}1эy $JUƉ$T$蓦t;[^_]ÀxuE $zJƋED$4$^.t̋U D$}$|$9gz Ɖ뢋E $J}Ɖ|$$.lE bUWVS1ۃ ut<t5t)t""€\ Шu܀ uڃu׍C$I"ǍXut.t' t3"ƒ\ Шt\ u"C [^_]\n" "U .tċE UWVS1ۃ,}+E $HƋE ‰EBME 3U9|(tk}EE4$D$Ez NjEuE'_ Z|$UT$ UD$$z T$@<$H/>u9Mt M,[^_]Ét$$Z }.tދM׍E\$4$D$4$]tEU,[^_]UWVS1ۃ 5 9| [^_] 9.}ߋXuu $ \$$ey :t 5 뾋5 Utt8udD$$1҅u$^ $D$軚$ ^ $D$蟚$!^ ~$D$胚$-^ b$D$gUWSt] uDtL1щ $F\$$tpt8u-[_]$Iu$TFtŃ1[_]UWVS U] :Tt.B$!^ $D$D$$ۙ[$ٝ $̝pt 8$^ D$D$k$Cpp9UWS$^ &$ ^ sB$!^ _$-^ KE$o^ 7t8ua$z^  tH8tCl51щ $B\$$֞hңlt:u@[_]áh1щ $B\$$茞hfD$$V벡p 8D$$p8D$$ÕvuB1щ $<\$$谘Č[^_]ËUČ[^_]1Eу|D$D$ $脓E>"U?tiED$|D$E$E<$}t+E$uuVE%E$躕E<tE $wu$TP$oE$Z1UWSÃD$$F0 !t Pt:u)1щ $;\$$[_]É؉<$[_]UE]U$E]wUWVSuD$$F0 Et@uxE1t1ۉ4$74$7uvES$$Lt 1}[^_]EE1u.z4$f7t1щ $9t$$ԕ[^_]É4$k4$V.0 u "t <$u4Rx|$4$D$D$ [^_]É4$<$5UVSE$ tHD$$?"$"$ft)u4${4$f[^]É4$f1[^]UWVSE]} sg_8 C vlCz x$T$:EƃJ@<$t&菋t$D$$4C u MtVEE[^_]${ *uD$D$z $ъt$$ Mu[^_]ËC rkvw^C7 t C$DEơ t u CUPEC04$D$D$D${ @D$D$z $$OD$D$<{ $щ\$D$D$l{ SBE BUD$D$ $>Fx x UWVSD$ D$$ED$D$4$#D$ED$ <$EÉ$E=tS|$D$4$E¡x t x UEt ƒ Шu1[^_]É|$D$$D$D$<$gD$D${ $I$R UWVS<X@R މЉ ƒ Шu#t$| $9-u y$*1 $8D$ D$$C$B wAӋRG $a1e[^_]1;to$=L$$ƒ ШD$D$$;t t v K$v> R4$ t u N.5 tJƒ  Ш ƒ Ш XD$D$ $`Ӌ $.C1t:;D$D$<$載D$;;t$T$ƒ  Ш1G;t+ƒ  Ш%$9 >1 D$$S覄D $:<$9.D$$ { D$J\*>D$D$$F( $n$a$ʉt:;OD$D$<$蒇($9;t4$T$چ4$L$61;R4$7ED$D$ <$ D$$l%t+ ȉ Ӌ$1ȉ1   CD$D$ $ t$D$t$B$A1׋у)̍D$BD$$A Q D$D$$k VЉ FF,1򮋅щ\$$qt$`19}u‰ׅ$l$$І軀8贀 $6D$D$$X<$qD$D$sD$D$$CD$D$$ Z<$輅$|$2X  tƒ  ШD$\$$蘃x:68 u㿋D$\$$dƉ D$$葿 $荅D$O $c|A1򮋅9qt$ T$]D$t$L$ $<${  ɉv<$)X$W}҉$Y|}8Ë$|$诃$!|;D$D$$茁gb}8É4${$X;D$D$<$3 1}kmn$D$D$<$܀$L$ 0bD$$yB89Džxt'Džxt1у\$D$$xz;|ۋ8t$1;t uf$tz}$|$D$ uE%=t1؀ D$D$$xكλ.]VR{8u׍t&Dž.{4$y|{u$\$UD$D$ $(D$$t$节uE8%=t3E%=t$|$t$ |$<$ $xDzD$D$ny  $fxDžzك8|UWVS } tx uK t u:uu6u 1[^_]ÉD$4$ [^_])X뿉$TS t x tUV1UStJ 1Zw $H| 1Ƌu[^]1ۋސUE]US]$S[]UVSu^t0t)t$~F&Ƀ[^]Ë$~ۋ$HUWVS]t, t&StU t*t#<\t<&[^_]ÃԋM MEM8!11ȉEC$:@EC>$~9s~l=Ѓ D$D$E${1.u1uMQ MQ9sEPE 9Et M ${}E[^_]D$ ED$&D$E $EUWVS,Eut 4$GEE$"?E^E;]}RM}M;]}}9<1Utщ $"T$$~M뵋}EMAE,[^_]Ë1щ $v"T$$]~E@@E,[^_]UWVSTEU1: M1щ $!$T$|M;]|EMEUHB[^_]ËE@[^_]UE0UWVS u $t<8@É<$KD^C1 [^_]UW1VS $6<1ɉE𡠖 9ljE}IU 21ҋDt ;M|UEzP 1[^_]ËEUz0E P 1[^_]UWVS1ۃ $;EE𡠖 9ÉE}bU U1ҋD tD tu }u;]|ԋu}EwU z[1^_]ËUu}wUUE z1[^_]UWVS1ۃ $:EE𡠖 9ÉE}bU U1ҋD tD uu }u;]|ԋu}EwU z[1^_]ËUu}wUUE z1[^_]UE1UpE1UVSu$9R1҅uSS^01[^]É$A^1SS0[^]UWVS҉EUEL $9L EP t}ptU9P uڋN1M}щ $KVT$$1yƉtJƒ tE t@ t9u8}cEVEUP1[^_]ttUBы4A3UE]U1҉E]UE]UWVS1ۃ }=  ݀ u$U819ډ}-Հ 9|Vw 1[^_]ÉVw [1^_]UVSu$7` $` ?^C1[^]U{EJ1UVSu$7'$r?^C1 [^]UVSu$_7$8?^C1 [^]UWVSÃ,S1B$7sE<$ E08'ExV1E~Mt{} 8tU9}MOEt E$qtE,[^_]É$eC$36E|$ $D$Dqu&MU< E1U܉MuA}܋U؉V9fEx)1}уMщ $$T$uEUWVS u ]u>uTt\=#1҅u7T$$Уu E [^_]Du E [^_]-$$)su1߹щ $%\$$uUWVSUExP@ǀHt&vt& t&@t&t&.t&\t&t&t& t&t&Bt&pt&@t&t&'t&d E[^_]ø\ P.D$$6E$_4UH .hD$E$6E$!4NU4 .6D$E$b6E$3U .D$E$$6E$3@U W.D$E$5E$g3ǀUБ .D$E$5E$)3U𸼑 .rD$E$j5E$2\U𸔑 .DD$E$,5E$2 .U𸀑 _.D$E$4E$o2@UX !.D$E$4E$12UD .D$E$r4E$1U0 .D$E$44E$1vU g.^D$E$3E$w1HU ).0D$E$3E$91U .D$E$z3E$0 U̐ .D$E$<3E$0U𸤐 o.D$E$2E$0D$E$;Ɖ$ D$ËE$2E4$r7$20SD$? E$Ɖ$D$ËE$l2E4$%7$/@D$b E$衪Ɖ$qD$ËE$2E4$6$/D$xE$TƉ$$D$ËE$1E4$6$K/D$E$Ɖ$D$ËE$1E4$>6$. [E$$諿Ɖ$D$ËE$91E4$5$.E[^_]UWVS,}D$$| 1ۅÅtHED$ D$4$T$h$| D$tIt ,[^_]$| 聞tlBuQtUE$D$Y`ED$ D$E $T$$| D$l,[^_]ÃB막$W$| USÃ$| $| $| $| t  []UWVS u$$D$.Et F$'_ D$$ËE<$D$$ljt#M ~ t9t@u6$'_ bD$$E [^_]É$i$ D$$aE [^_]UWVS|UE0EE@ }Wt+1:|tD$U$j.E$+MEEq YUJ }Gt$Et E$4$d1XD$}<$T*E$'UB  MARMA@ U@ D$Ë}<$)E$w'4$/E|[^_]$_&D$UËB $=%.\$M $)E$'}D$|$E$2ËE19]tUM $c]16C{׹D$D$D$ D$$L$芈1.<$E܉$C7E܉$誷@$%%UE؉$CE8Ext!Ext1уMԋ]1t$EԅCMЋ8tu܋}؋w}Ѕt EЉ${bEmU@ aE$U$E>] 1 t!\ 1 u߉\$M4$L$ OEWA9}hM W  u   tɉ]v4$aMA 1| Ã`A<$D$#W넉$M+CC(PEe}ԉL$$|$+^qE؉uăEC1u6UċMJ$"$;GC FFщ $S$T$b룉$`$MPaD$D$| $sY\$$Bm1UUWVS}u<$t[$t@ED$ED$ E $|$D$$1t 4$_[^_]D$/<$.^t$ut1[^_]ÐU$(@@@ @@@@@ @$US]u>C u=CuECuMCuUCu]C ueC$uh][]^[]É$^Ct$^Ct$^Ct$^Ct$^C t$^둉$^UWVS u$(ËV FCFC1umVC 1VC1VC1VC1V C1V$C 1?C$ [^_]׹щ $V T$$_VC 1p׹щ $VT$$_VC1M׹щ $VT$$i_VC1*׹щ $PVT$$6_VC1׹щ $VT$$_V C1׹щ $V T$$^V$C 1щ $V$T$$^C$ [^_]Ut$ oËU1҉tB]U]UuD$lV $ Uu É$USu[]D$T$E$1.tڋCuC$[$[[]É$uE$i0t'C$3.uߋC$*u1[^][^]01[^]UWVSӃ @$(u3t$$O> D$V4$X $P [^_]$P. UU1WVS= }1Ep5MD$H= <$ru׋=#… ШtL1>011ۋU u4$GW1EG1ۋ0<= 1=ut{=>uuD$4$>\uD$D$W. $Ot$$uE?m1}[^_][^_]É4$,t U?뽉4$E뭉\$4$F,?럐UWVS< ]1EEEEEEEG$p. D$$D  D D$}. $bt[P(w t&$0/ E$p. E<[^_]Ë#D$}. $U u1#}P3ƀDt&t&51}S1}1 }\1}>tC$uE.U$覴y#UeZ#@EJ#E:2# U!#E ΀gt&E$裳K<$Eҳ;E$!-M$LD$D$. $%LU\$T$$E$$t&$غ̵t&$t&$蒾$t&UUD$D$$֦D$D$. $DKU؉T$$U܉$ݫ;<$D$诠1EtE$譫$ιED$D$. $JU1T$$OEЋUи. LuZ D$UЋ$. D$NO2EЋuEЉ$1EEԉ$ͣEUЋt$ KUЋD$D$. $IU$T$E>E$. D$E4D$D$. $IUT$$uND$D$/ $rIUT$$EUu  tD$D$/ $I$UVSu1҅u [^]D$4$Y҉~#9|9s 1[^]|wD$ 0 F$UVSu#1҅u [^]D$4$҉~#9|9s 1[^]|wD$ 0 F$DUVS]$u>#f1҅t1C04$ t5][^]4$[^]ÐUWVS,$q9 t @B$z9 ǁ1C@9p$9 褁8@.X#SC  VF UWG >EUD$B$fUE$T$D$G2EEU4$D$T$(2UËE<$D$T$ 2E… ШuPtLE\$ L$D$$0 K12x$z9 肀$9 n1,[^_]ËMA$LD D$D$$i1D$D$E4$N1tD$EtD$$= lJ1닸0 ڸ0 ސUWVS = $V QƉD$$V u t @ۉD$$V u t@uHt;t$K 1[^_]D$$a$ NۉtUD$D$$&0  뎉t$D$$#0 轠 9'_ 9'_ USÃu$ []É$J$[]US ]D$+0 $t1LPD$+0 $WuϡÅ1ujۺt8$D;t$8J $ C $nA1҅ua[]5p []ø $ á`D$$C$CD$D$.0 $B\$$J $DpUWVSED$E$tpD$$sEt 8u`$ I E1tW]tPBt $t1[^_]D$$H뎉$H 1uEu$Du"MtK Ct=[^_]1t9[^_]$>0 Et$;H4$? B8ËE$>Dt;1ۉ4$G[^_]ø t$Gщ4$UWVS,5 ]t$> ,[^_]á ED$+0 $Ht0LPED$+0 $u1 ="ɋ#EuzkC:-u z$CEUE~tNmEEf,[^_]E*%xEmEEtf1}эLI $}D$ËEމ$t&Ut4$@EU4$F@$}?D$E$4C D$K$D0 zE.CEED;D$E$D$t$EU- 4$EED$E$u oE8c$5E$? $1-E$V 9Ut8u0"@D$5 D$ $9 $*9ÉD$ D${0 $8UUuD$D$s $9$$UED$'_ $1҃t 8UD$D$`; $8UT$$VUD$D$0 $v8UT$$#UD$D$0 $C8UT$$UD$D$9 $8UT$$UD$D$0 $7UT$$UD$D$}V $7UT$$WUD$D$0 $w7UT$$$UD$D$p1 $D7UT$$UD$D$1 $7UT$$UD$D$b $6UT$$UVSuE t9tdD$D$0 $6\$t$$E[^]ÅtPE D$D$0 $_6E[^] D$D$T $56yD$D$T $6UD$D$0 $5UT$$US]t.D$D$1 $5\$$c[]D$D$1 $5E[]4US]t.D$D$1 $N5\$$[]D$D$1 $ 5E[]UD$D$$1 $4UT$$UE D$D$D$ E$\Ë Uɉt ]Á= t ]à ]UWVSE ]EEt9CE1}щ $IS$T$-= 3}… Шtt$:눋u… Шu]u[^_]Ã[^_] $$b U]U]USEE]tJCuOt?CtE$D$uC$E t2$EU[]Ë8-uxux-u$US]t_CuAtTCtE$D$buCCu<1 $ []Ë8-uxux-u먡l[]Ë$0E[]UV1S1ۋMB<w'ƒ\ЁB<vtt[^][^]UWVS tucuD$$8tD1щ $T$$:[^_]É$|8[2$1D$ơ $D$R1ËEt}?uD$D$1 $1t$\$ D$ |$$01^UWS]u.1щ $\$$9[_]É$7U1WVSE}L уMP  tE tx upE t7V1уtR}8t[6P 9p.tE uE ubEt$MV8uϋ}L$$|$3uE u'}uR]막L$|$$3uE tك[^_]ËED$F$g뭋E[^_]át8D$D$?1 $b/UT$$[^_]D$D$?1 $*/ML$$觰USEt8@t,%tZB< vB1Ƀ+tҸt %>u []Ã-t0?tf$L$[]É$u뭃랡 D$ D$ D$$1;L P늹UWVSuU9UE|EUw @MA$}?E}EttED$UB$iu t = tD$UB$.tD$$= W2EEEuE܃<[^_]ËE$$P'Uҋ6> $ $x1҅,[^_]Ãn.EEF21\$$G: $M1.[U6.ct $ D$|&[E: $ D$W& $: $1҅% $V!,[^_]ÐUWVS1ۃLE}?D$@3 <$Ƶt;aw$3 SL[^_]D$@3 <$莵 uŋ =#t t E tM15 919 TtTuEttEt EtDu$H3 D$"5 뙃#E>tGED$$@EUBE1ۋ5 @9E}) E9Ãu]+ iëEȍv$GMȅɉu +Uȉ R$T$L$ " = t$#- 5 1?$ 臤EL[^_]É҃U EtE}D$U$T%EEuEuE$@EEEh<$ #CEt}C{D$4$}OECBCBC B CBCB}?}-UB01эY $t$lj$$_strDuct|$E$6D$D$3 $5\$ U|$$T$<$"OE4D$D$V3 $UЉT$$$L4$D$ D$jE܋UԉEE E]܅Uԉ$S!1E.`$Б $ 1҃tM?.kGD$$.tхu tPtiP뙋PG$E띋EЉ$$q3 D$Uĉ$5 )$US}  E0ҁt u U[]ÐUl!u$c4 Ã$蓸$c4 UWVS]}$c4 JD$$D$$!D$$ D$$|  D$$H  D$$^t 4$D|  | t1u 8EE <$uD$EC8P"ETD$$!t?EtHHD$ t$D$$y4 P;= u$ U E܋E܅M$ $4 x$7|$TE܉D$$ˇA=  E܉|$D$ D$D$$EE܉$<$e$4 8$c4 "t EQE[^_]ÃE܅>t $4 E랋E܅lEEi E$4 D$$" .6nG$fD$D$$ |$$Y $4 .== .OB84E܃8(E܋@ E@ E܋@@E܋@@ E܋@@ E܋@@ x E܋@X {    E8E܃8E܋H E܋@P E@E܃H@E܋@@4$+ t, = , C$}T t, = , TthTD$$PxeTD$D$P$ ËT$P$ D$$}oT$LT$KՐUWV1S ى $>-Í@t$$ [^_]UW1V1S,EE]D$4 $螟t+ctzt&eau~5#D$4 $suաx #$X1x t tI$,[^_]ÃlulEv],[^_]D$ D$D$$E$|TEEE0E$tEU9t$]hU$~WUE1ۅ t 蓷u\$UT$E$}E<U$r$D$D$4 $ \$U$T$E~ut U$ u u'"uE$U$xEt U$w$"E,[^_]ËE$GpUUË$. E1щ $)t$$b$"Jv~$t&J` 6 BU$SEU ttáuD$$4 7UVS t@=~ t4=: t-= t&1ҋL 9} P tx tE9|=l!… Шuh!Il$4$D$D$4 $D$ $J~ ~ [^]U EtD$D$4 $U$ US ]t2 4 u4 D$ $ $[]UWVS1ۃE: u؋U+"ҍXtwU<-Etrt ,0< vo1}уۉMxEt9U:ty[^_]ËUD$T$E$Kuԉ[^_]ÿD$ D$ D$$Dž|t +< 9~[^_]ÍDy1UW1VS1ۃlEEuE5 #t#@1:-D$‰$4uiD$5 4$8tTew$5 t&l[^_]û 뎿EE࡜#E֋E؋5#t U؀:-EFD$=$NEcMM$ ƮËF1щ $裮V$T$ }C1щ $xUT$$^ }܉CtM܉ 6]JE1Uԅ.E1ۃ8 Uԋu+"XFUԋ6EFUԋƋM /;u} u]E] Eu]t};]||"EEt+Mԋ@D$ 5 *D$E$UԋD$5 D$M $^u9~u1}<$F]؅1ҋ}й]߉ι $۬ËED$ E؉D$D$5 $D$D$B5 $?E$uE$j]܅t }܋E܉E E1tFUEtJU9Ex5U1щ $ Mԋ$T$E]uąuj \$D$5 $`t ;$D$D$B5 Bl[^_]É<$Y-zz&e1߹щ $d\$$M]ĉD$ CD$C4$D${[4$ۉuЋE$]Cu!$t!C3t$؉$t&щ&8 .18 u< $ .1эA| ;4$t4$5$Uމ]LE@E4D$D$5 $$}ąg]Cu&$.HC3t݉$Ӊ$vD$D$'5 $$D$Mޅu{EED$D$$=5 E~${D$D$E5 $\$Uu'_ $T$E.SqDKD$b < D$U$:$t&o-H $c5 sE$Y D$LED$$9D$$ E $"$c5 QU1׹у $ËED$n5 D$ UWVSh,$$D$$T$\$$f4$Zx;L |It5 tF$5D$$D$,[^_]áP t@tnu @ $|$x+D$$D$,[^_]Åc RD$D$5 ${ST$$("U Eu$kÉ$9.uꡨ#f1SUS Mu$"[]É $.u #ɉtt tu1ۅt B8&t1҅ۉƒ[]xuUUBD$B$5 D$O1UUBD$B$5 D$&1UWVS, uu1D$D$6 $$Ž,[^_]EEEE1D$6 4$腎tMCw$P6 ,[^_]E뿿븡#EEE뜋5#1ҋE…u{E"E4$C$裈EtȋCt$$5 D$뽡tUXtNMY $T$u1$&6 ʽC$)6 D$[WD$D$-6 $ZT$$(1=CE$Ƚ1} 1}t'D$/E$`tE$i1ۅF8Et^E$at,$ D$E$4C D$K6D$ D$E<$D$6뎉<$̟u͋Mt<$葅E<$.u<$iu<$=gEt$`<$蚼EU؅t E؉$E܅LB $لt&h$C6 C0 <$"xD$ D$E؉<$D$eUWVSlEdsED$H: E$֊u؋#҉UMA$AtPEQD$D$6 $$D$. U$;$> @EEE'_  MAE1}уۉM1="RE\$D$U$1t*=\$Ѓ D$M $N D\$$6 D$] | Lt 8/1ۅuEMEEE^D$D$6 $kUT$ $T$T$l[^_]覸l[^_]D$$D$$6 D$uˋ A /OD$$tHD$$D$$  D$D$(7 N$D$D$6 $F\$$T$ u $1l[^_]$ D$D$L7 $$M1; EE"M D$  ED$"MDD$E$EU$G: T$Eug1}эY" $ D$"~EE;5 O$ 1$ z뿍t&ҵ$U$t$*US 1҅tC1ۃ8u< ؉$l1҅t%9 ڃ[]É$UWVS1ۃLu^D$8 4$t;Aw$9 rL[^_]D$8 4$譅uʼnً5#1tqtlD$D$8 $$]둃YQ vF>ˀ=#0@( @(t]vtO"u~tD t ft"4$D$É$Y$1 1.")1u t$C$`  D$E$ D$$ NEt$OÀ4OEEtD$4$裹҉EЉU.1ۃ8u}ԅxؙ;U|;]1$] 'Nj. "t?uN1ҋ҉D$t:u'_ D$ @$8 *D$؃< D$=돉$sEf??+]L1vD$D$8 $S$T$虱j $谱F1E?MSu l"5< %"D$D$E؉$@"w")< )"룍E<$D$赎t;< M䙉Ẻ֋U9&|9w E%9|9D$D$8 $<$D$ݳ~E܉$|$D$ D$$0#U؉$DžE؉$(U؉$O#]ЃU]$^ %^M+M̉%-%9 $鐐UWV1S1ہ,DžDž}轃D$`9 <$DtDl w$9 ӯ,[^_]ÅBD$`9 <$uۋ=#*F8%tB6DžpDžaWMC4$t&軹.x;L }P tF$P ^@$T$輗6D$g9 tաËp<$bK FC@ C \$$ˇ'$}Ɖ$!$g9 8>u;G$ڱD$\$$?h$h$D$$h\$D$$k<$_.rP dYdD$ D$t$$蜘C1D$D$x9 $$譬}t:~t1b4$芮1Su4$#1:4$;1+UWV1S1ہ<Dž}蘀D$t9 <$}t:ha&D$t9 <$|uƋ=#Dž><$t)5P 1ʅ u; L } E5 tG$訯DžD$$D$7?-h$h$D$$lhT$$D$.D$G$谈ЉӋ1ȉ1 D$$艎ru:Dž+<[^_]Ët? $4D$D$$I<[^_]D$ $} t4$R1v4$;1gUSÃ$Ct\$D$$9 臩[]D$D$9 $UWVS<E! 1DžDžDžDžn }>uK-1't$<$裄M MMUB8-uul.ustx.unvth.p-t&.V?t&G1v4}nΨ<[^_]ËEE@80t$ $譃EEM E>p<%?h$D$$$T$\$$fM $Wx;L }P tUB$(D$$L$ EEMA8-D$UB$xȉӋ1ȉ1 ?zD$ۋT$$苙EEM1<[^_]à 3 $UB<%7D$D$9 $MQ$T$舥@tjXD$$D$D$$T$蛘Y؃sHMAx@XD$E$<[^_]DžxD$L$$荧t# $Y$FEE<$ǥ#UVS]tSCu4ۍutEt$C$FhMtQu [^]Ë8-uŀxux-uD$D$c $$躣[^]ÐUWVSӃu t1}U  1}E1Uu,hЉU왉1ȉ1 uM t EU 1[^_]Åx#9|t&9rUȅҍv.~؋E)у[^_]Uu$: D$+: $HUWV'_ S,EE}EG:-:-:-:-:-'<+<- Ш<ED$G04$G1ɋU]8+E\$L $d?Å\E1;h}`$;h|h,1[^_]ÀzzlM?뙀z zcM?zzzvM?[zzpM?;zz-..<+<- Ш $訡,[^_]ËEt)W;hK1$vF  ExED$D$$B: $}^hE҉U]EU`D$h$A: )ЉD$BEUE҉UxT}U`D$ny Eue D$$J\ EUE҉Uy $ D$ $h|E`$opE`$VU G$؟+Et8-j-|+t -ED$F$x-VhM]UԋEԙE9ډU9ۍt&6Mt,V8-bxXxnN6MuE1t$ 膢øYEE&h;dUY5`UԉЉ<$h)E1<[^_]Ë8-xx-6vvxx-6t&'xhЉUԉ+M]M]htL$ 臡øt^=h`UNjE$S<[^_]D$D$a: $=$<[^_]$  ]MډE u1Eu뎋Fh뽋h5`Uԋ}ԋ|}}ԃ DyEUDȉUڃ׉ u1EEUt7E#4$讑$f:$W1/ExNjEF81щ $?V$T$#F$vnЃ dD$`$âƣ`hE~UVS ] -€+ Шt-t|E$D$>u1҅t3EEUM4$L$Et(x; h~ 1҃ [^]Ã1t$$V K [^]þz`UWVS ]u D$E$ EU u E;h~ [^_]ËU`$U1щ $}UT$$M` [^_]UW1V1S ;=h}1`${$|$$D;5h|$t: 1t>$z9؉Et`$]$Â|$$u) [^_]û $蚂|$$ςt׉$ [^_]þ뤐UD$$ZU $D$謓$#UVSÃ$ ut$$([^]Ét$$[^]U80 Ph4  8 Pl(  8 , TUWVSDždDžDEDžHDž<pDž$Dž Dž4DžDžDž0Dž8DžLDž@  ehpD$}:  $daw t&$ ; l[^_]ÍED$#$qu]}1؉1 4<$\td$D$D$: $w4\$T$$TED$#$pqu]c1ҋE11 PEDž80Dž<DžH#$ED$#$cpu]}1؉1 @JDžD;# ) # 8#ɉpt0- (u Dž('_ Džhp$p yt8$: 4 $P$uDu u <$҂ [^_]ËU|$$1UWV1S\E tZ1ۋ D5Z d 8t 1MD5 uE1$7gEEġ ts1 tW|5t鋃 D$EE$ 1UăEэD:E u}U}ċE1$< tPЉփAU$< T$PXX8 1t tY}ĉ<$\[^_]É$;[v $҅UWVuS E}\$$-u$軿t$<$duփ [^_]UWSMt [_]$< .t@Ātڨu֋CE1}щ $feST$$L.t$B$%UH d ]UWVS<}&RD$ <$Nt'?uC~1=#?%<[^_]ÅEEG0<-Etx-ƒ+ ШtftR?QouzɐtAtt -t+u}1}+$D$u?nu… Ш(]̅1<[^_]ËEԉ$D$0YEJD$ϋEԉ$\tVt-~-?vEvTÉt$G$B= K.;$Q$1&||1X1t&EԈ]EE؍E؉$}E|&D$<$RD$+$xXD$+$vWExUW1VSEE]OD$< $Lt.fvED$< $Ku҅#1}CE0 t4$MY4$1t A St A1}AfD$D$< $ht$$zEC1}[^_]ÿ4$5D$[4$胲EE4$bX4$|E덅4$1t EY4$LD$D$< $膳:= ub T$t$$$yED$D$< 4$oy[^_]É4$`IE $D$1E(D$D$< $$x[^_]É4$wUWVS1ۃE }ut OtD+ftD+itD+rtD+ttD+x1DtE 9 ,M t ۍEuX D$$= ƶOu1} tJ tA$Q1[^_]ûEaOBD+f5v.uGu'_ $ D$Ë$O> D$$$1[^_]É<$D$a1[^_]Åt}E$= D$D$еD$GD$$脈$gE 1}fEav$F D$D$GD$$UD$E$+t2@u,E 1ɉD$=* t=M tL$$[1øùUWVS ]utA4$DDžt+EE #GGtuE t  [^_]É4$tw@tqP$\D$Ƌ$VNjC%O GC t CO C E C4$$OE G[D$4$tAP#H 1щ $[ST$$ҷRD$4$ǁHUWVS,EEEEE}HD$'= <$'Et4fjaoED$'= <$Dű=#E t  Et E >u44$RE%E B?G0EuD$4$WSt4$Rtf=EE$,= -`Eԉ|$$_`E܉$E؉]Eԉ$eE܉$ED$E 4$D$?@uu)1},[^_]Ãnt'pd>s,[^_]EFE:E !B4$tt1ED$D$0= $wt$$'rE4$U e BE  Et} te E tE} te .1ۋ But@}uBE tE1ɉD$=* t=M tL$$뽹4$菲UED$D$$UED$D$$UWVS}D$<$wÉ1 t{裣9 |y9؍t&rq؃|OuJ~ ɉMuv؉}1[^_]É$蓱묡">t3D$D$C= ${D$1tG$s[^_]ËA81щ $IWMQ$T$*  E$ 1t&tAD$D$}= $x$,l[^]l[^]D$ $|j< , D$$է[1^]D$D$= $$p놐UVSUt3E$D$pD$ƋE$4$觬؃[^]á8[t [^]Àxu$s BkʐUVSE$hl]X$\$Pt$$@ $\$f` $ D$ED$ $=` D$$ t$$` D$$ 蛫`D$ $_ D$$ o1ҁİ[^]ÐUWVSE@tvEt ${EM $EV1 EStQutG tnSt~E}|$tiD$$= ٨Et U$ת[^_]ú= u׉uED$EtFD$$= 밋ED$EukX 됸p ujED$θkX UW1VS1ۃEuw=D$7 4$9t#lt\pu`D$7 4$9u݅5#… Шt<1>1ۉ؃qC~1t&1i[^_]ËFE8t ? 1<-D$<$Ctu{=&6t2D$F$CuԋF$j6u΃[^_]D$$s[^_]Àl.Et2D$F$8CtD}tV~%}t6u΋E[^_]É$H6Euډ|$$E6̋F$i6E봉$Gw$= <-fVEvG<$DWD$<$wBu=  $)\$U$T$$f5 襞D$D$?> $UT$T$$谡@$ tD$ËE$I> D$臡$菣$2D$D$V> $qUT$$B`D$D$m> $AUT$$D$CD$E$s$谝m$裝D$D$> $UT$$賠$: bE$R$T4 AT$$$\$D$$WU$$T4 ќE$D$D$> $ST$U$T$ʟ\$E$?> D$讟*$象1ۅEuU1WVSU6]EES8-t44D$> }<$"1P$v$> UvME<-}p}-}a}-.tKM8-.wUHM@ uy> uU@p\> u׉t܀}aMAltbU@a:_[^_]ÃMeCMe6M@-M$M0eAluA돸> uz}G$_ U1҉~ 9 t:]UWVSL }~_*tt}ȘL[^_]à ttuٸ1҉WV1҃L[^_]ÍE؉$D$ʙ.x݋E؋U܉VEUW賘!Ft&.p뛍E$D$w.xE$D$Z.i]̋UMȋE  Ӊ^]ԋUċMЋE  Ӊ_UVSÃPMtO  uD$'@ D$4$蟞t$$.@  D$QE#E u$9@ P[^]ÍD$t$  \$D$T$ EU T$$$\$t$ T$8P[^]Íu T$D$ D$C@ 4$NUW1VSlE=` uuA ` aa Sb Hc ~ ;H D /D$` 4$,trS2?t&H&E D H 9@ #ʉDAD$` D 4$+u5#} 1 4D$EȋỦ$T$~KEЍUȉ$>t=tԉ$讔D$C $N@ D$Yl1[^_]ÃaMH @ T$$VA D £@ Mn D E9M})@ ]RJ D ]9|E-t$EEU$T$EE D 9M."]@ ڋTUUU1ۃ}}Eu ɃMEU$Ec]@ Wl[^_]fW@ fD tF1L D %EЋULEUa@ EUĉEU^@ uUMUM79@  uEE8 D$D$@ $7M@ ʉ$T$U$kD$D$N@ rϐAD$j M $Y]$#XU1҉VS uEruu2w@u2x1Ҩ uEr]uwux1ҨuErMu wu x\$t$L$ $@  [^]UWVSE ]EE1 tC$@ D$y%gau u-t+ tC$@ D$ywruāM$ u€, Шt!u-&+t&ot#uvt&8x4MI+M = D$D$@ $r|$$"S[^_] €, ШD$D$A $%T$뮃=uf!uE EE[^_]UE!EUW1VS1ۃ u&D$@ 4$v#t"StupuxD$@ 4$W#uދ5#F,0< wX$ ZƉ$ $1҃ [^_]ÃiR [^_]$ӋÉ$ɋӁ\$F$¸t %.tƉ$膋jv[$cƉ$Yt@ u'_ D$$@ Wut$$@ C D$D$@ $BD$F$dTUWVS<E$R#E䉕D$$#P>u;%<$&lStxB8B< w<$D$-[Ӌ11 0$b`yd!ꀋE䣔<[^_]ÍX$X$D$+$X\$D$$虍$Zx;L |@tB$eSD$$D$GP tD$$T$$^z`E1ң<[^_]É<$QEU E] UVSÃ$-t&t$$1҅t@t[^]É$P[^]UWVSL]1w"D$'_ $#EԉD$$DSuԉẼẼxPEȉU1?:E 1ۃ=t  u$@|$D$$NjMątE   0EED$W^ D$C?J  $*A D$ UEUҋENËẺ$L[^_]á E Uȉ$^E̋XU̡B|$Eȉ4$D$ỦljZEgfffȃ))ҍA0шDuۍD$W^ D$ow$C t&G[^_]D$B $.u‰#2EC$ uEt0C$z< D$-D$谅uE8vtBt91- C4$D$utut1$t$1 D$C$p< D$,C$GE1Rt E .d1 .C$ 9Ut܋ 4$a̡ AD$D$B $?$Dڃ4$a~$t$U'1U t 1á $襉  11= U] 1UWV1S$">OE tF1ۋ 1щ $S+ T$$6U  uE[^_]UVSE$0D$$0$Ɖ‹E m4$X[^]UVS]u t4x@@$ Ѓ$؋1[^]Ã҃1[^]Ԑ U'_ ɉtA ]UWVS҉U: %EEE$$C |$G{-uEыE E>y EE.EU}9U…u}])!ËEt $ D$/19}M 1D$$ 9|>y $ D$x[^_]À*.4C< F0}UӍDBЉEC< v.!*t@B<  ƒ0 MҍDBЉEB< vjMMUSÃ$"{\$D$$+C @[]UWVS_,M]BރVw+$`C D$D$;C $z$@\,1[^_]Ã0U1҅ !A<w.UUEDЉEEA<w m}uUE),[^_]E)uEE蜂EEUDBm}EQUۉE}UTUv%AшEۋEDɀ}Ev ЋUDЉEE E)O E)B E)5E)(.E)E) E) E);].XEE)UWVSEU1}UӍ{p;5 wd C$D$ED$~ UT$UT$$}ET8 T0 D0 [^_]% D$ $ &£ vU B]@ U11҉WVS tA<'<" Шt[^_]yǍE$D$ D$D$uËEր8u?"t:  [^_]á 11@$6@ ơ @NU0|~ @,=w| =t&s塈 @UWVS  u4$3>5#.FE8U 1҄EE]tQ\EEEE.%tKҡ D$$o}u 9U1ҁ[^_]É]%>u&;$$C D$tuۀ*>u FB< v.]!$TC D$VtuD$D$E $uML$$e;=  $\u[^_]ÃU$/Uá $D$*>u B< v+.IEMEAEG7Aw$D D$D$] $t|$ EEt(@8<'<" ШfEU1ҋEM13E $[C E}1}&UEEUE1}pEEL$UĉT$M $xEUr{lj$Q#D$D$<$PEUt9}1UT$ыEȃD$ $UE;U$RzUMEA.t߀8tډ$AUM<$T$L$GEUEM3E1 $[C EE1}fEEEUD$T$ UĉT$ $sw 1tB  }1}UED$MĉL$E$F t*؋@8<'<" ШCgP$$Y ۽HEۭHE1}E1}b|$EĉD$ $ov1EEE1}Et E8 EEM= # $p  $%D$` $w  5E EEE<$EI$L< E"E1}5EE|ED$UĉT$ $P$L< EE1}EbE E룍t&C6p  |$ UĉT$Eȉ $D$~tL$ MĉL$EȉD$U$\tD$ EĉD$UȉT$M $D$U$%tc|$ $ptED$ D$D$<$rx|EЀ8ct9" |x E+odẺD$D$<$mE۽h8.d8"\ ۭh hL$E$,sj $J}EE<\EtbUUtuE܋MtU)щM܋}.MĉL$EȉD$E܉$E<$t?tEEU׉$tNjE؅EkD$EȉD$U$|$UȉT$L$M)EUD$ T$UĉT$EUT$ EĉD$UȉT$UEU‹EUD$T$ $$ $s  ED$ $qEEU멋ED$UȉT$rEUD$T$ UdEՋEU㡈 @$4DžxDž| w @$4۽h  @: @M.E<$45UWVS  ;E5 >^  E|$U$iۉ= t~u  €}: Ѓ !y:[^_]  5 V ;E}U 9-t[^_]ËE y-tuytۋM  ƣ  u/ ;UtEBM   98t̃  ܀yup u|=  '_ U<:|:롋 u ?"D$D$E $i|$ M D$ T$$Vi?D$D$E $i|$ M D$ T$$iE Uɉt M  ]ÐUWVS] U;+;   щ #5 A40:5#Yt$$-gEX:tS;tN#  A <u  #[^_]Ë  A|tYD#   tAE-tet+t\  #[^_]ËH:t@-(t + A lE@Et-+A#  $  +/  A <u   #t#?[^_]Ë  BD uqD$@$r  A  # ?x;#F,0< D  #뺀}-Ex #E$  -? ###$  -U# ]  ÐUWVS,EUEEEED$F $$@AE5w$G ${F  -+,[^_]ÁM링M@랁M땋].tE낋MUi 1ۋ5# 8uT$4$duׅi$  UMM@MMMM MMt&M# # # ~# o# `# Q# B 1=#tG1  t3 8uT$<$buӅxv  UD$D$~F $Hc#T$$(4$*+t&E UEU1}$< *UWVS $F g^ @^ 4H t&Wkt&@ǀ@t&t&@t&À3Gt&V j~vt& t&F FF+FUF$FF <$b [1^_]D$KF $F e@D$OF $F e,D$WF $F eD$`F $F eD$jF $F we@D$rF $F Ze^D$F $F :eD$F $F eD$z8 $F e D$F $F dD$[y $F dD$F $F drD$F $F d@^D$F $F odǀJD$F $F Rd8D$B $F 2d@(D$B $F dD$F $F cD$E $F cD$(\ $F c@D$6 $F cÀD$F $F ~cD$:= $F acD$F $F Dc D$0x $F 'cD$ F $F cnD$0F $F b]D$c $F bMD$7F $F b =D$>F $F bF )$4D$F ÉD$$F Zb$bdF$4D$F ÉD$$F %b$-dF$v4D$F ÉD$$F a$cF$A4D$@ ÉD$$F a$cF$$ 4D$F ÉD$$F a$cFWD$D$F $F [aF ?D$D$F $F 8a<$] 1[^_]UU]BRDU$~O UWVS]EEEEED$EU D$E $     Ǹ1҃}…#ts1ۉ>uG\?tKG$yuD$D$G $[W$T$ ?u[^_]1Ʌyuti1ۉ>u Q?.tƋG$uD$D$G $ZW$T$: C1[^_]Å ƋEFEF1 F 1 F1u F17 F1 F1 F 1u'F$1tqt$C$#uމщ $ T$$b뱉щ $w T$$ZbUщ $E T$$(bщ $ T$$aщ $ T$$aщ $ T$$aщ $ T$$|a`#1cU1WVS,ME1ED$EED$       $0øf1s #t AfE'_   OEEUBEB 1vUB  15UB 1UB 1UB 1rUB 11UB  1UB$ED$D$ D$D$ $Lt@u E tGu Ett G<$D U$؃,[^_]ËED$D$$G $V$D$D$TG $U$Rщ $ T$$^щ $ T$$^щ $ T$$b^cщ $T T$$7^"щ $) T$$ ^щ $ T$$]щ $ T$$]_ED$ $nƉ$>lj4$%UD$D$ $D$D$~Ɖ$lj4$s%1D$<$#UWVSMtE8u 1[^_]ËU$qtN uS1u [^_]É$Zщ $ST$$\ċ u`1E} ;эqEM8tVEE.Fuً}<0=uݍD0/E$萍.@@t&t$L$$VuU]UWVS ]t;uS [^_]D$$\<=.u1щ $\$$[0T0$T$_.t@B 1[^_]US]t;uS[]D$=$Pu֋Et+E $D$¸.tċBB1봉$BuUS]t;uR[]D$=$Pu։$з1ڐUX ~$T~ X X X @U\ ~$S\ ÐUED$ D$D$${RÐUEU D$D$ED$ D$ ET$$n7UWSE؃@U D$ ET$D$D$D$ $37É1щ $z\$$cY@[_]UEU D$D$ED$ D$ ET$$6UWSE؃@U D$ ET$D$D$D$ $6É1щ $\$$X@[_]ÐUWVS } uEt$|$$BXy gP8t݃ [^_]UWV1S }|$E D$E$Xy)u$t&P8u~ȃ [^_]É؃ [^_]USd ] 9` tu.D$D$ E$1` ~+d t` P ` []d []Ud ` ]U1҉d +` |$~8D$ D$ډT$E$R` d Ãw` d ÐU]VUE D$D$E$[NU tD$ $D$ $ U uD$ $sD$ $_ U 1ɋUtҸ t  u]1]UUB BB B ࿉BljB1]UWVP5 t6} u4$xt$$ƒP^_]UE` 1]UWVP= t6} u4$xt$$CƒP^_]UUB"߃0B1]UWVP t6} u4$xt$$ƒP^_]UE` 1]UWVP t6} u4$xt$$rƒP^_]US]$-x ][][]UWVP t6} u4$xt$$ƒP^_]ÐU1WV}S\=D$E D$Eȉ$PE$RLD$D$ ƋED$ED$Eȉ$8H}E1эA $EK$\H l$\H sEċ@E1}Et]tY1ED$$D$/QD$)UT$D$SQ|$\$ D$E$x3;}vEăH$P4$PEȉ$mIU\[^_]ÐUS1ۃ4EED$ED$E$Kx 4[]JX.tut&U1WVSL}щ $EEUD$$Qu D$/4$9GE}ȃP11tE\$4$EЍEĉD$ EȉD$VGup]ątdC D$CD$C$PECUD$C$D$OC}<$GCÅu]7$oNt$D$$4C 5HU$N؃L[^_]ËCu$iH Eĉ$(EqH0$pH E$FEĉ$D3$M\$D$gEĉ$D]pD$D$xH $G}$|$jHUSUE ] R++Px S []É@Bx C[]C[]USEU ]@B =?B~-@BCA[]ÉC []UWVS(E]D$E D$E$3{]E]MmE )ʍZU]EܸCm܋M܋E)i@B)ЉE4 )42ljEܸC)i@B)׃}UUEUU؁,]؃myU1ɅUtؙ([^_]øgfffu)UCWVSE} 07Hȉ)i@B)ӺMb؉))i)É؉=~Ӂ~FU[^_]ËE[^_]U(ED$ED$E $[MȺD$H )‰ЉT$))ED$EL$ $CÐUWVS EtUE$H 1эQu 1EэAt >.D߉$E u/t/u;]t$qJE [^_]Et<~]Y$V c~Et01}щ $@UT$$&L$.@~/!AED$$US1ۃtUT$D$$FuE%=@tt[]ót[]UWVS,]E ]1/EtXEE/E/EUUUUӉ>uF;]E8/E,[^_]ËEE.EEUUӉ.tE E؀/tD.~;]t/ 1/uE uq.h/ux/gH/1}LkUB8~/„ Шt);EMm.5F/9։;rv$ft$$IFDž8/x/x/.Dž$C:/\ [^_]~m98_Ĝ[^_] n1{H :UWVS$ËE E1u}уM> 1ƒ Ed T$t$ D$D$H $$@` Bw EDE D$uD$$ =y>88u4d $<:13=E [m1^EtE[^_]þH 믉$b>UVSE] D$E\$$1x#H uO D$4$5t ؃[^]É4$6퐐UVSu$ u@C[^]ÍF$1҉s 9|C[^]UVS]u t@9s| [^]ÍFD$$@S 9~s[^]É4$:US]tu[]É$C[]US]tu][]<[]É$ ][]UzU 뱋MEyEUɉxBUBtE [^_]ËU UWVS,E]t E@EM Et U RUM}1D91ۉ$t;uEU;]}MUM<1tщ $?M$T$=U};]|1 U܃;]}@U M܋1tމщ $M $T$<}믋}w,[^_]Ë}UWVS]E ۉE}st UR҉Uu ؃[^_]ÍD$D$EM9MMEE9E}TMUM<1tщ $MM$T$;MEE9E|sUtE[^_]19UWVS,utMtG^t@E tCE 8t;Ext5Ext(1} уM,[^_]EE}E8qEx5E EtE?EtEt1уMEUED$ËEu}UD$E<<$:E}$X8}9~.E<UEEUED$4ËEt} $|$:UD$E<<$9EtUT$U$9ZEx1}уMEUWVS u} tPF1ۅ>DD$$8 I59^~,D$uٸ'_ $8 D$59^ԃ [^_]UWVS u} tF1ۅ~$ׅx9^ [^_]UEt Ptu]ÉE]DUWVSut\4$2$ UÍET$D$ E 4$D$3UMCɋECtU؃[^_]Ë]t E1UEtu1]ÉE]Ue]2Ue ]U1U: u]UVSut1ۋ$5u[^]US]t$][]5[]U1WVS }tbU1t_M 9 EtH:u\$U $-uډMD4u$+5 [^_]à 1[^_]UWVS1ۃ E$$ M9ƅt:1щ $M$T$6Eu [^_]UE E EE]@3US]$d$D$ ~ D$D$1[]UWVS1ۃu}4$蹈8$|E$D$^9E}N] '_ tU$M ɉuċ$3UE$D$9E|t>t $N[E [^_]ÐUWVS\ EU NtSt8AVCD$$)DžtM\$$)Džt-tC4$D$)Džt Dž91T$$2҉$m/. u;8.uDž28CVD$$(Dž\DžR\ [^_]ËExuU zu8.t :..tӋE D$U$1(\ [^_]ÐU1WS]э $'Htt'tu'A[_]\''U1WVS ]эL  $,ۉ"pt$ t @t!\u"F [^_]À€ ШtU1WVS ]1щ $ۉEƉt tt1uE [^_]Ã\t B @.tU1WS]эL $3ۉljt#tw $H u[_]9u\U1WVS ]эL $ۉljt$ t @t\u [^_]À€ ШtUMɉt"t uw $J 9t u1]ø]v9.tB<=.t<:ِUWVS]t;u 1[^_]ËE ߍD$EEtLUUt7t0\utFރVw8$L EUEt E)‹EE[^_]Et U\UEtƒ Шt EEEE[10BЃ0#M<w$MtЍB<w m}uET{AE1,EËUDBtAm}t7StvStɀvtЃUDBuE}mEx\EW t& U҉.YE7ut&,Dp=w (ЃC9/M+E*StvStɀvtЃËUDBuɃe}B:UWVS ]t;u 1[^_]1߹ $E$@']t`ÉރUw$ N *ӋDP@ug\0؃$0C0EUu'Mt+}E8E [^_]þE\뻾rfvnؾtѾbȾaU1VSUt քu1[^]*DB@t.tDB@u[^]UWVS}]+E $1ɉƋU Ѓ19|>u]t E[^_]ËEL$4$D$D$ D$4$([^_]ÐUWVSJ)U DX]t ]1}} уMEэq9u|b(]E jU9t%EE+E9|5U;Dxu;}uۉt$E $D$'uă[^_]Ã1[^_]UWVS@DžDž]E $D$\$F$uU B%=@t @[^_]1уD$`UE $D$$EEÈEEEE(\$D$xO $'((T$D$$#u8%=@t 1@[^_]Ëh(Eȉ$\$D$O '((D$$T$#u8%=@upEЍ(\$D$O $&(($T$D$"O8%=@9@ D ,13(p Ɖ}u(  u13E u 9h(D$`$@ D$1#{O uO (D$ \$$D$O %((D$O $D$(%1(у $Q#$.G$$x..tP1򮋅 эLwT$( $*&((T$$D$:!uTXEhUEpU9t;~;@5$$$!"Ut EЍUD$`$ T$a!D$`D$ E $F!1;= D$`D$ U $!АUWVSu M]}uf F><EE]CL1҉ȉ B0v#BWv=Bv >,$_1҈uEtbƒ ШtPm{0t0Et-C[^_]É$0.t$0um1 Etgfff#))0 ~B0zE-D$D$O $W$T$D$!;G[^_]à tk}ȃO .ڃu߉ȃO ݉$0.$0u w4UA0ӈBrmڃe}$ X0{ɉx-gfff))ǍG0׈uȺ)A0MˈA뮐UWVSLU]u ҋ}uE E>^EE.MzG}r}EE؉EȉU܉ỦEU. wN0UԈE؋U܉$t$D$T$ É tq}ԋU؋M܉L$ T$$t$vEȋỦ$D$T$ t$̡#Wt&뀉$0 uE5}ƒ} Ш}0t0Et-LG[^_]E-D$D$O $U<$D$T$EiL[^_]Ã} }M ؃O  .u׉؃O Չ$0 .$0 um1} E#gfffmEM))0} B0 C0zBLUMĉ$T$L$ t$̟w =wE؋U܉$D$T$ t$衟> у$_Zme}$ X0]uxZD$ D$ EUT$$/0D$ D$ UM$L$趚U ‰EumD$ D$ $t$0D$ D$ $t$輝EU\UWVSu }u $u|$>uy1ËE;X yX j9\ .1|$- P # P 0 %P  |$  & t& D$ $FUS D$ $O  !gD$o $O  gD$[ $O fD$. $O fD$ $O fD$ $O fD$ $O fD$o $O fD$[ $O fD$. $O mfD$ $O YfD$ $O Ef []U d H  P )D u D $ $] :$G $5% $G t $j @ 6 ,@ u D P d P %P #n L  t)D$$1Ë H qD$$1á$-$+$$$n C  $P US=$ tcE$` $, ,#u#t$g( c؃[]1UU$|$B#B B BB< BP B#B B$L B(| B, B00 B4H B8D B<$ B@BD BH BL1]UU$B|$B#B  h B BB< BP B #B$ B(L B,| B0 B40 B8H B> D$ D$T$$9$tt$$ut$$1[^]U$t;|$t1v1>u'D$$D$ $z:$1Ã-$1UE;|$ $1ËE $D$ 1UWVS $} P @#%P ƉD$ $|$ 5  =|$ =|$84$ D$  |$$=|$9~=$ #9ىMtHEDpCы.L5$;5|$.9 M0P^ӋUEWD$$눡EEED$$D$ $0~_.$|$9.}E$EUMȋ5$T$D$ $xDD$$Z$9} p5$Eȉ$.$|$9.)M L$ T$D$<$E$j2E$u"D$$f눋ED$E$US] DXu` uHE$D$uiE$1P D$t;#D$$$1[]á $l$$^뛡#;|$}#MUWVS:u Dp1 E=$4$D$Q]$:P \$DXtoӋ 1ۅt#‹Ĥ $D$C uP $[]UW1V1S1ۃ$tdED tAC9~߃E<4$ED$o$ƋD u\$4$D$ q D$f[^_]ÐU$譏1D~US]1҉ӈыDD~[]U D ~~@L ǀ @D D ~UVSut41t2 ރuD$~[^]ËD$U|$D$T$$i$ u É$UWVSӺ xXm$mt@ P >^t;E4$D$\!%P t&É<$&ڃ [^_]ËED$F$4!UщVSt8u [^]\ xʉ $BtO\ ơ\ $á u?|$$#[^]'w?w$t4$_UWVSӃt9t:t&t$ ƒ  Шu/qƒQ ШuW[1^]4[^][^]UVSD D$D$D$ $[W D $"t1t[^]ÃF[^]US1ۃtUT$D$$uE%=@tt[]ót[]UVSEpD$t$$$1҃tDE1%=@t<= t;=`tF=t&t1=t<=tY=t5ڃp[^]ó/%@߻#ֻ=D$4$u*밻|USÃtD$/$t8u؃[]Àxu9v8/uPЃ[]Ã[]ڀ/.tUWV1StD M؉D$ $-EЃE܋E܃<[^_]ÅD $^D$R@DPt KӋD $D$EEEkD $^D$D D$$?뷺<\e}"D$$.]_}'$_}"rM$5 <tkU܉|$$htK@ t!|$$Ot$)E}~}衴|$$!UtEUE tEU E,[^_]á |$D$ D$$I ;}!5 U8>EE$Mu:E܉|$$MEЅEyvh\$4$Ѕ5볃Mt&~$t&MeUWVSlUȃEEME9M}̃}v&uEEEE $}EtDG8t:kv 9uEUMt B<uƋ}9}~}EEȃE9ELE1}t U:9E$u‹Ẻ$1ۅD$ q D$}ȉ|$Ẽ$1}Eу9MEU9U1ML$}|$UċM̋$E}9}~͋ED$ŰBD$$St$ŰMEȃl[^_]EEUM<M‹DBt=ы.}MW4 DPtы<.J{v t9.-EiEU1ET$щD$ E܃$L$UËEP1ET$щD$ E؃$L$QE܉$E܋E؉$9E܉E._EDEEEUEЍEUԉD$ED$UBD$ ED$ML$$P.4EЉD$E}$EDE‹@Bl[^_]ËK$>8 1$D$M $҉ÉEML$}̋G$D$1щ $brM̉}$|$CEML$}|$UHED$M̋UċD$$}9}(UWVS,EU1<  1}tV{u$хa3O{u19E,[^_]Ë31tu;111щ $%qT$$ EC DtHD$$Guߋ$EύQ؉4$ [4$N $pECU9t UuEU9t$HUEt+$3]m$#U1,[^_]Ëp$t$qu‰4$E@뮍GD$ q D$D$C$w3UWVSui<t]<< ШuED$ E)؉D$D$E$@EE<u;}~}܃EMU؋Fӡ;L |6芨D \$D$dW $D $1t^M܉\$L$E$TK.rEӉ$xvoMS<[^_]ËU܉\$ $T$Ѓ<[^_]UWVSÃU}tutktb8 tYEtuQEEt9t0D$4$t Ut4 >t|$T$4$ЉÃ[^_]$D$suUWVSEE] UtE$E(twt3 1uL:M1t U8T0tH$t$<$D$b;}t#}[^_]W 8L0u8u[^_]18)UWV1SӁUt $u\t?\.D.ux|$9$1uGČ[^_]Ë u0 tD.묡u D9.tfU냍E$!Č[^_]É<$ËE t $tc}\$$|$uE%=@tb=|$9$1u.$Č[^_]Í}\$$|$뛍E$sv¡T t$t\ <u|/.t</t$ы<诹2DPы;<}1wу9u\$t$$[XM8A>q1у9"\$t$$轴밋My..Dyt&fy.%9Bz6M1Yщ $l]\$$U$˵ 9$ 1$)$.@$Ѕ$讶=щ $\T$$蒸$ u)1$á$$ 1S1׉ًUΉU؉֍~}E)ȉ$[áD$$M|/.D/u3$脵2$m$ US$=L m J $#%,($(A$<4E80$$D$Hq8T$ U\$T$4$0$t$oB薖$ $g @$1[]É$$$ $,(EE)((u 0D$8$($ \$$Ы<D$8$@$1[]ÍED$<$y$84W $,9,,u#$u7$$赲$訲t&d $荲뿍(ǔ0 D$8$mUSU] ҉x6Bw1h t( Ѐ>u\1[]á  \$1USE] t \$$~E\$$[1]USE  E D$E$@ []UED$$U E D$D$E$U1҉S1ۋEM &<u9DuD~ډ[]UWVSM u}tz1ۅtmtf!<uE|tbLtA҉yك=h t<uJЋ$<ttD[^_][1^_]Ë {.tD؅t[^_]UWVSEEEM} 9MEEUtI\uڃEMU t2CƒM Шu9CЃHw$] EU E륋EM} [1^_]Ë}|9-uθ Z uiEU ƃEE蹰M}9DP読Ӌ$U M}<9}MtZCEuME}9?t%:ӋDP5Ӌ$U EEU dEE1ۉEU} :UDBm} ލQ\vQ\ɀv\ЃE뭋M} 9 M} 9 EU  GEMË}9B<w-EƒE\ЋMEB<w m}uڋ}E m}EU \M} 9tEU M} 9 VEU  M} 9 8}t m xmhUWVS,EEu ]t>u}G,[^_]1эL $REED$U4$T$|31ɋU9E<.wh tGwq9}<TUEDE˅t(Etu}>uUEE$U9[U$,[1^_]<tK,tt 1 ut7 t D$D$OZ 4$蜤D$D$UZ 4$|uV^D$9 $UtD$b< $<; .$pI` 4$D$  1[^_]0߹щ $I T$$耥$D$-ޚt\$14$薢t 4$D$聢t$ HUlt+19} H<t9|=  1øp\ C1UltBlHD 1ø[Z  1UWV1SE }E t(1ۋ <$D$象tQ  uڡ 1t,1ۋ <$D$~  uփ1[^_]Å.xvE< Et'E0tD$S E$EE[ t D$W $ttD$ Y $Ѡc= l M.Dv  2EE[^_]<1pExcWl $US]D$D$b< $Iu   1҃[]D$D$9 $u   0[]UWS]t>;t9$u<1щ $pF\$$Y$1[_]Ã[_]É$'UdEt8u L 1D$ D$ D$$脜!1L UVS1ۃu D$4$tݠ u1[^]Ëݤ [^]UEt ]UE$t $1҉US];t}D$wZ $xtuD$l< $dtaD$|Z $PtAD$S $E U D$E$UWVS臭$ ED D$E8E<$q T$$ËEte=1;t5|$ D$Z D$D $$Quˉ$BEEUtL D$\ D$D $= 9 tb< D$D$J[ }D$D D$_[ $֊$uv D$D D$z[ $诊L D$\ D$D $葊= 9 tb< D$D$[ D $etue $Pt(D$D D$[ $"[^]ÅtyD$D D$[ $[^]Du@D$D$\ D $Ӊ$ $oeD$D$[ 뾸wZ 뀸wZ RU#uT $?1áD D$D$D$ $e ÑT $1UVSӃtD$4$Nuu1[^]Ã[^]UWVS,]t< <  Шtu1,[^_]Å.tt#.t$;1= u1"ȅt':1 t t<3ʅuك:EtMtD$V0 $軎43t €  Шt uɉ 1  tO 1 ut9 t, €  Шtt< <  Шu\$4$&C1s< <  > €  Шu> tY 1 tK >u` 1D$$蚍` u޸[  >t7 >.t €  Ш.t>.t< <  ШuxKf>u~1<3ʅtu\9"u<3\ m<3t1< <  Шt!<3t €  Шuߍ3E'€" Шt?Ƀ1M<3ʅt't1\;Muɍvt<3t/ € t3t< < u31U;"D$-$ 1t"D$<$踋 uƺp t&舍Dp5膊ыƺd t΀}'€" Ш1EшEȃtU8\>uD D$ED$E$~|3=Ev4$d A*{MD$0\  $|u9ED$ E𡄤 $D$ ED$U$t&4$D$ s<1щ $0E1S}> tu\.tڀ"t }>ۋE0U'€" ШtQ1}уt}8\>uD D$ED$E$}<$U$MD$ $UWVS|Ed`$<xED$x$D$ȆxaD$D$x$覇px91ۋ}EU11 u G9Np$讁Džtx$ t|u=D9Et39}1щ $.UT$$ˊDt\h]9sd19t> >9t8 u>t €  Шt u1#u4t>h9rt$!\Ĝ1[^_]É4$Ĝ[^_]É$.|$D$Ƌp$莉Ëp$>x]t$蠇4$蓇kU1WVS = uIED$ 5`$=hd~tSEp5`=hd [^_]UEt8u<\ 17Du$G\ 7uո<\ US$[]ÐUWVSUt 8EE!$,(NjEtGreveGrse-G i-seDarchfD)`D tt$$N]': |$$G: <$  [^_]1уMRUWVSEԋ#$ P UEMEEM:=tEÉ}REt; EU uMM$z+E}E9}UMċ}U9|塰UMĉUEUJEȀ$+EEUxE$EЋU  M1}5$уM P @Y%P ރv xK <u@D=t5 O=e5 T= W-\$}<${av2u)x1}tC$(^ ۍt&.x Àt&tCƒ Шtt$XM]ċD$ $膅-|>t$_U}ЋE9U=|D$+E$*5$Ut }<$Eĉ$%P Č1[^_]ËẼ;EB21}1у]}̍]Ѓ@}9|UЋM xE+ẼEE<E̅t'U8tiu}ԋEu;uE̅uً]}ċD$x$ChU9Ӊ5$]>u$UE!HM̉|$$L$~u뛋}̋EЈ}-E؉$D$D$Z)mȀMȉL$}Љ<$'E\$}<$xU U$= 1щ $0'E D$]$}Eĉ E8ExT}ċM1 M}уۉMtU8QM9Me}ԋE}uE9EubUU}̅|@EȉD$UЉ$&EС|D$MЉ $*]$UE;~]ԋ}}mU̅mUЋEOD$M]ċ$eE}#=$XEt U$Mĉ $z%P Č1[^_]Ë}=$;=|$A 8$';>u$ $ ;t ;|$|؋M)PD;E>|  M̋U8M9|MЋ]N}̋|$=$9ЋM)XD;E}89! M̋}9M;|$|݋EЋUEȍDEȉD$UЉ$$|$E뤉T$$vM9M}1+uV`t&}ۃ}ۃMtL;u.t=D$E+E$^qMu9Mt= 1эq]#KEȍDEȉD$UЉ$#ErUEU ]LUEU ];USÃuc 9$# $# 9; |t\[]á 9}9 D$$# D$$"{؉ T$S"$>"$)"[]É؉ JUtt @1]tUWVS,E19UEE1]9}BEU\$T$ $D$w@wvE9E|);u}EEU\$T$ D$E$w@w8;uEE|+u7,[^_]Å.t)NҐ.tދE)Ӊ$b{xzrUWVS؋$D$' D$$quUWVS u} tt  9˅u+ttȍV)9|$t2;$>u)$D$' D$$)q19`t>$1D$' D$$p9}D D$$t9|tv 5 [^_]1҉4$ 9sv t=)$V랋9.}D D$$t9|r1҉4$)‰$UQ1҉4$j [^_]UVS~áD $ D$su5[^]U$Eu uD$' D$$oUWVS1ۃ ؋=< щ-=d5|$$Bu|$$1u< D$ $|qэYLrv $=$ۣ~tr1199 9~< t 1[^_]á<  t 1[^_]D$$ny Su1҉$:=< 5< Ut 8u` 1UVS]Cw  1 u,t'D $D$bqD $Ej[^]áD D$D$D$ $W dr7Àu2orڃ@DPtloڀ@ҋu?iD D$D$D$ $#Z fqUSEU xW< tC~/t.qӋP[]èu̓[]ÉЃ)Ѓ[]Ã= UE D$$D$ ED$xi 1U<  1U< u'_ ]1`ádUdh壔|]lhl|UduGhuOdh|lÉ$nht$nUWSu:< 1G$ED;;[_]1:udG$uuED;;1щ $c\$$Lpd|l[_]1эyG$t$D$ou:(1эyG$< $D$oUVSu4$AO~D $ D$\mu4$O~ PDu[^]U$uGOD$' D$$iUWVSUȉE̋҉Eu =t)EE;$ lEU 9ЉE}u9M}EuEuEu+];] }>tE;] }E8uEU+EȉU;E}:tE;E}}?u;uE9EthČ[^_]ËEȋủEE .z.nU:.bE+E;E .L.@}:t׉2Et&jFEU}U9E19}tU}B:GEUEĉUEEu xU}9=t<$u tdEt1уM}+]̅u  u $jỦ$T$}E+}))lj}iv  EEEu= u4U;tt)in a t+EEEE+EEiv ]E19E|9E~=@?;E}5$)$… ШU  t Sht t(E9Et D$ UD$D^ $T$b$$t 8 $t:8t5]>u %$D$' D$$euۋ}|$E$zJ$8>D$' D$$d5$ E9g U~$EE}g|$ UD$Eȉ$D$dÍ@1]D D$U2$g9|=EE})g|$ UD$Ẻ$D$od1}C}̍W1T$уL$EE$nbED$UȉT$}̉<$eeD$E+ẺD$Ủ$艤ẺED$E+EȉD$}ȉ<$f9uċ}9E.EEEEED$}E+}ȉ|$UȉD$T$ ]+]̉\$Ủ$tcEĀ8 !ED$\$Ủ$ˣẺED$|$}ȉ<$讣9uċ}9EIED$D$}D$D$|$ Eĉ$UĀ:U:ev E_Uű}M9} UEE9U EE-E11ۋủE>.E؉\$D$EЋUȉD$|$T$ Ủ$W.|$D$ D$Ủ$\$D$ D$NjEȉ$̠Uȋu‰U+E;E hBUT$}<$,FČ[^_]É1 mm!E9uċE9E.=Uċ} :t+ $nE9^ tu Etta}tZ];$M$t 8t79t2>u & $D$' D$ $_uڋU+U҉U.T$}<$EE$1҉EU+E+Uȉ$EDME;l=9l;=|` $D$' D$_UdT$$DLbvYEu~UT$}<$BD]u+]+uȉ)Eav eUUUj$}19}Ej@}E;=l… Ш1}?}|$E$CUU+UЉU+E.D$]]$^C})}1ҋE$5D$ D$})}E<$D$腝E?}1ҡd<$EU+E+Uȉ$E+ủEEĉ+Ẻ$E)Et/}̋U8}|$Ẻ$D$^űUUuU}t+EE}}}|$E$ E$ }D$$|$XD$' $D$\ED$U$kED D$‰$?`Ù:r}d]$1ҋE1҉E4$E{)E|S_v t ED$ D$})}ċEĉ<$D$貛ED $ D$DD$' D$$[;u~D $ D$R_È8Uw}̈m\$\$$WD$' \$$[XE̍tE$_hUWVSlE@ LGQ= E]؅EEc8t =;=< t d`1эqht `<EljE;= |M% D$$V D$$;Eءdt$D$EE܉$-^UU܋M؋]+5l5xuE1D$5D$$];5$d1]ąt1эy9}#$dU;$ 9|ݡh}̅}EỦ<$dU+);5$hMEE [v  E];|$ U<[v5u+E EEEEE܋ 9]M; $Gw  N   t U܋M؃ ^;5$U|2B;E EM܋]1 E]܃E\@DP Y@U؈;5$|2B;EE]܋M̉E19Zv EM; |$W]؋E}ԅ B;E: E܋]̉D5 $8t `MU`;$ 1;]Y 59'_ =`59`D$ !$ xtL$$\$[ x);tE)u+x$9yD$)}ԋEԉ$]=D $P   r=dtl[^_]Ë'_ 1+j= E]EE]t5t*ECEjD$ <$KUM `)҉EG1уM M܉ωM;= |M1 % D$$ D$$E؋Ut$T$EE܉$VM]؉M x}%=x= UEUD$ |$+ED$E D$E$iRE D$$ D$$M; $Eg]܋Ẻ]ԉEV?])$)ˍ[+}܍>9)ƍB;E E)EỦ9]܉M܋E M9|Tt& UE$99~M܋]؃ $EM9|8B;E'E]܋M1E$9뚡xtl[^_]Ë5U 0$#8U܋M U܋B;E EE܋]̉M܉]؈Mq|$D$@^ EE܉$TV$9ǍB);E E܃EU)EIE.gE$SEE9]܉M܋E M9|1;EEUԃЙNjE…tS;UJ; >$)ȉ$*$D$$D$$D$$l£d1փED$$$D$$£ỦEԉUF8 @?EEED$ |$D$ D$E$MED$$ U;$}U M܋]8M9rE.}*E]܋M1E.;5$|B;ED$$D$$£OvZ$]d\$D$$`1׹$уL$X1;E~N9H54$Kt$$;$$;~MЋU9  xEuE5luaE~Z~Q;|Idt?$$t$0\Nv lx5]UЋuԋE)ޅ1}t 9Nv t ;54$\$~D$<$/}~ ~ .D$$D$$D$$c£x;tE; $ЉƉE)4$1эAE+xM܋]̉Mԉ]oEV $EЅumxۉ]D$${@)$.ELv =t=5"xUq$D$D$M؉ $Eq1҉4$1ҡd4$ xMD$' D$$THd,US1ۃ t tZ $t%$tL); $tJ .D $D[]á<uA녉ÍA$\$$D D$$D$TKsUWVS,$$D$' D$AG$A$.D$' D$$$G~7$D$ $9I>u+,[^_],D$ $I.tՋlUp5dU|=hUUUlD$D$$|dh%EUlEp|UE5d=h,[^_]D$' D$U@ uá$QD $oBD$$jU$D $0Bá< U9t$)1Ʌ~љH]á$)+8 ِU P $@w %P ËE$ҁ%P UWV1SX<%L$GE$G\$D$4$?m t'\$D$U$aFU<[^_]ÁXm u͋U<[^_]UWVƍ\SӁ}$$Gډ<$$t Ĭ[^_]ÍX|$4$D$"?U t t; t t1$@i b1úm $>m $(m $$ m Mt~t uQm $`m $$m  hD$ $D$=돍hD$ $D$=cU $, US t =tU t =t Ĥ1[]Ílh$4E\$D$@$L=뽍hl$D\$D$$=\$D$$<\$D$$<\$D$ $<\$D$`$<\$D$$<\$D$$<UF( @UC|Kt@DUVSuP ΀wo$^ P xD$\$$At$$F/9|u69}2<1~t51[^_]Ë  <9~u$Pa 观|$t$_<1~uˉ)PU$ ËED$ $D$bBU$TE$A|$t$E$'[1^_]U1WVSE] uэYу9ىM)uu\$E 4$D$AtEE+E9}Ճ1[^_]Ã[^_]UE E EE]?UE]0 UE]0U.BEB UBEB USA]DXt b8Ӌ[]USA]DXt >Ӌ[]UAEDBɃU1WS]щ $3\$$B[_]ÐU1]UWVSU=X uk; C$ÍD$#£=X u&4[1^_]Ëtڋ tЋU1ҋ}щMEэL $DNjEM<$L$At$<$4$><1[^_]$1ۣ$>19}1D9|t$<$@ED$bUWVS }u 9t(t$<$Ét$<$"19‰(X  1[^_]USEU x8$T$$'$9t D$$|= t1[]؉E[]$#1[]USEU x>$T$$&$9t D$$= $t1[]؉E[]8#1[]US]E xM$t6D$$J&$9t D$$= t&1[]61[]E[]$#1[]USUE xB$D$$%$9t D$$!= $t1[]E[]#1[]Ud |$$D$$#k 1UWVS$uE= }UD < <  Шt*Yۉى$t[U[D< <  Шuمt<D< <  Шu'Yۉى$tD9[< <  Шt܃jL$E$= t1[^_]d1[^_]á$#1[^_]þUWVS$}E5 \ ƒ  Ш $\tw ƒ  Шu܃/tׅt\ ƒ  Ш1/t=MM $A\1Et ƒ  Ш1/uɃHL$E$= t'1[^_]Ã/i;1[^_]á$#1[^_]ÿU$u 1D$$= $u#1UVSÃ#$9t)D$$ۉu'#19$X 1[^]á#D$$$U1]UVS5#$9~Ƹk$\5$[^]UWVSà ҡ$=#E~LD$$!$#~L$D$g"1U=#$ [^_]D$$9"$#$D$f!1U=#$ [^_]UEx ]4؉E]UEx ]؉E]U t'$$B4$1UWVS L =H{ t={ t [^_]Ët1=$щQ).xt%  81u1T$\$$3u|$4$5$x D$$1cUWVSU]<ۉt~ 0=vu#=4$<t|$<$D$yHt8u[^_]O$$25 t$$6X[1^_]ËE$D$5$e rUEEU ]US=L | ]t~T   t+$ U 1[]á$$U 1[]áu~, x ̐U$UPU PUPUP US$4tCuC $w4[]UW1V1S1ۃ ? P $4 P z P w*BBtkBtDYB $$8@ $3 P 9td-|$$"$ϋ=$똋$z [^_]Ë=|$m|$O 1[^_]\UE9Bt u]ËE BEB1]UD$ D$D$$1UD$ D$D$$-1UWVS}u 9~9tLt$<$ft$\$ |$$FD$ t$|$$*b1[^_]U tu1%1US]|u1[]Qt.tBu1[]ÐU$ PPUE P Uu3u;u %P É$0tŋBB$0Uu]u1ÃU B9|KtgAD$$E ËE  $Uu=uO%P É$/t$U/%P UWP ucT uP 1_]Ë=t1щ $T$$0$gP UWVS ]Q uQt?1ljщ $T$$h0$uà 1[^_]PD 1[^_]LtUQ Mt:+0 %P E MU]M$U9(]á$(U9Љ~)])¡( ])Ë$U19(t.@$( 9$| $]U1҅t$xE$@]Ë( E$@ݡ$U9(]US(1ҋ]t*t6(@;( |([]ú( P $ U, U~, ]UWVShLߡH $$1҉ƹ h, D$ F\$DžT$D$$$L[^_]UVSE$+;Ɖ$[^]UVSE( $_ƋEE <u7| u-3Eu4$4$*[^]É$4$}4$*[^]U P E]$ 1U1%P ]$ UWVSL$ 0 tL[^_]u w.t΍.u #?H h$n" Ɖщэh, hDžD$D$D$ FL$$"x#ÍD$D$T4$v)~p9É~;=( } Dž>u/H $$ É$D ƒ  Шuu¡ ^IH $$ 6;D$D$4$&D$4$ǀD$}&D$D$4$*|$D$4$I&.L$V  $/# gUVSu]$" D$t$$n)tYt! ttȸ[^]É$$.x߉$D$t$$)uE[^]UWV1S,EE}EE;u }D P @j;ED$ E܃%P t$|$$#t tt,[^_]ËEUEUUWVS1ۃ} EuD$D$<$&;]}DEEED$<$au P @ƃ%P ;]|[^_]ÐUS$ED$E] D$T$ &uE$E$$~S$$~u~`D$$a$=$$$$$$[]ÅHt$_ $넺$돸P$Pwt-aHT$!_ ;£$<$9\ UYtmD$ D$ D$$!£$$?\ Yt*D$ D$ D$$V!$$ $KUSM] … Шu"؋$ $u$$[]U]UUM t$t$]U@ uáH $pD$$= S tUS  `D$ $xdD$o $xhD$[ $xlD$. $xxD$ $xD$ $x []UWVS ]H 1$$$$$= S HTD:HDE$D$<$\$?$2$$_ $$$$$P$$$hld`|xtp\XT@ $&_  &_   1[^_]úO$O$$xۉ$$ = S 9 HDHuE\$$31ۅ.` t$$%"d vܡ$1Lt$5$  $ u $$_ $(_ b1ۅ $D$<$$1u $u $t@$+_  1ۅtgۉTu\X    1[^_]É$$v$._ t$n S$Y£Dh$AHD$1_ @U1WVS L}t517w.` 8u|$$1uۋd  [^_]à 1[^_]UE$E1U$D$E$cU$D$D$ E D$E$xUS$Ut҉>61[]Å.~ӡ$$D$u1[]á$D$' D$$uރ1[]U$$ D$1U @ tl tt1áPu& $D$ $?1ω$D$' D$S1UTt XuD$' D$$UEt pu áttD$' D$$UMt,t"} tu(D$' D$$; | uڍt&D$' D$$z֐UWS];1щσ|$8; ʃ :$9} |$\$$vu*tf$:D$ T$D$$|$ =$|$[_]Ã1[_]É$u|$W tyu$9Qu+AwBAUWVSu} 9~ǡ|$9~ 9Ɖ|$!Ɖ4$)E|$)9ʃ |$)9uBE|$t$D$ $|$ )أ|$[^_]ÉoE$y|$)؋ |$[^_]á$|$U9Љ~$Mt#9~#]Åy$؅y]#US] E$D$E$$s)[]U1WVS ]u эy;= }. \$$=|$u6E [^_]<$c \$$i=|$tE [^_]USE|d~F|$ $҉~1= )É9҉ $x1[]ã$/|$y|$1[]؉E[]UU|E~$9|)У$$x1$$y$1ډU"UVS]u t tu ][^]|Y~N$\$D$ D$ $Sá|$9  t39$tT|$$x91[^]ۉu ][^]0D$ D$$U|$UVS]u t tu ][^]|b~ $ɉ~H$}1[^]á L$D$$}T1u봉 $ۉu ][^]U]yU]CU1$]U|$壐$]1US]t}$;|$to $`ub$|$9‰$|9t>9‰$}, $"t$£$;|$|ԃu1[]Ë$|$ۉ][]US]|~t8$t. D$u $҉$u׃uȃ1[]Ë$.t D$q.tѡ$£$uփuۉ][]U$ D$$蒟$x&1UT tE D$E$1蹧1UVS P @uÃ%P DXt ӋBtT~CtbDt!1[^]ÃAu\$4$`t&v tU\$4$뾉\$4$1[^]v t\$4$눉\$4$w\$4$bfU1WVSL}~p,t teE EEEȍG=2t E $1L[^_]áǡU 5D$ED$ D$$;XEE-G=}1ۍG$ĸEȋUD$T$$]9|4$ 4$g1U1 ЉU$cEUȉD$T$$];]|߅#~E04$)uۉ4$1U EEU‰$g1c5M=YEȉ$4뤡D$D$Eȉ$DEEEEȡD$$D$4 CUVSu6 P @e%P 6u] [^]UE ]U#t$;|$tl8   P t3 t$u |$t @ u1.1 $u>t&문8 U1]UWVS =$tx1;u}8]E $D$y$T$ $)ƃu}~@$<$D$a$;|$|= 1[^_] [^_]áT u$<$D$7D$ 4$$UWVS ]u =$D~>v t$$[$<$D$1 [^_]áT uHt $ H $tD$ $o t t$;|$uыDP@wj\$$裝$輠Qۉ] [^_]Zt$$$ D$\$$K$ 4\$$@>UWVS]} 5$;5|$~B v |$$^$4$D$$5$[^_]áT u vZ>uP$D$ D$D$ $.I$+ۉ][^_]|$$t$BE U[^_]7aUVS ]u ~ ( wr> t&StN' v tft$$|$9$}‰t$$~u 1[^]ËuED$4$D$vhE$U=| UE t E U]!]UEU x, $t- | u U EU E`؉EU|$MU t9$t U M]]UWVS 5$tB= D7< <  Шt'^ۉى$tD9[< <  Шu܋=|$9}F E< <  Шt*Y9ى$}U[D< <  Шu9tL$4$5$ 1[^_]U|$MU t9$t U M]]MUWSE $D$$=T tn1щσt! 8uL|$T$$1u8$:$D$ D$ $1[_]É$y D$ $1[_]ûv SUWVSÃU5$D$$$ۉEE4$D$;uE}I= }7E} ڋDXtӋ7;u|E죐$1[^_]Ã}Eu;? ڋDXt?Ӌ7 0$E ڋDXtu ڋDXlZYuEt&[^_]UE]UE]UE]UWVS$]u E1u[^_]Ét$$W$Et$$=$t$$$Et$$$9}9ljE ШED$E$8ƋE<$D$'E=$<$D$4$E$ED$E$$E裐$4$!$1[^_]XE䣐$U1WVS}$=|$$;|$ $)ã$C$裬1҉ $9|$$D$$D$ D$ |$$)B$$4$i4$1[^_]áO$D$D$ $FC4[^_]v t$$$D$D$ $BUWVS} $EE*~ ;|$E D$ D$\$$@, D$ D$\$$@9.wED$E\$D$ |$D$ $X@u!y D$\$$A먃mx?tt$E1[^_]á D$\$$A[(h<$ut$_ \$t ]E<0.s<\<\1}'tg}"t*ƒ<< Ш\&vF<><< Ш$.UWVS,EUE1}t EEEEU1EE 8 €  Шu܄: E}A;EE1}tE9E19}tUEE;E}cEE+uE؍F$謔t$ËEE$D$ 3EU؉UE 8-E,[^_]ÃEE UEԉ$E܉D$覔Ex@ 'U :.!D$@ $uuUEE]?UWVS,E$1G>E EE uU OE\} $,}$}E 9}9}  ШE EU 9U]E;] }"1 ЃM}M;] |E؃$EE];] }SD$EE$1EэDEC;E }UM U;] |1;]}$};]|4$pE,[^_]EʋMMUU M UET U E}|}UWVSE܅tM1<?ËE >1}tC4$=1щ $葐T$$tƋEܻ u-5 &}… Ш" %t %D$4$ӅE}ơ%4$ %1<[^_]ËE EEt$\$M $#t$E؉$f$.[\E $D$]< M %x|$EE4$D$lEE < %)x]܉Džۡ% %5U$U7M… 1ҨuH1ۋ9ˉE}$M9|Yt$~u4$oUԋ4$W$Ht&c$7v@U1WVSu I vE$ |1EE}UӍ{}:H U1EEUEEvE}t8t U8:UI :8Mt<\1"uIt U<:")Uut0M<9'htE<8\>u't9>uWU׍WU׋U<:2I M89|<$1}щ $藌UT$$}M 1[^_]ÅtD t$$u%.t|$M $Ѕ}OC$%EI MAA:Asȋ}|$$]1EEEEE}4EtEE;E}| }8EE;E||U }9}t E$QU.1}[^_]=}؋E1T؍MEEU $T$uU}BET:~1э}у>vZэ}EэY]9E|$mU9U}T$| $|}؉|$|E)؉$]I 9th9c"' &t=>E;E EM}|}:X}Et8D t$$1E;E.UM:|9ME@ED$|$ډ|ML$EE$.EP\t)D:D$@ $M<9.;E<8u}'+EE}t,UD:D$@ $ E)$裈‰EEE$D$U1эYM]9M|'m}9}}|$|$诈U|T$|E)؉$$E$ UU'\EE;E? E|\E=E;EE@ML$|<$ }|GUE`}E@UT$| $뿋]u ^ E;Ew E}U| UI }QEE$}U\D:$_ D$6EE]I EɈEȍED$ED$$`]ddMxDžXU1<:6} 7%* $6 1-vtL^ QЀ W…1t~1W у|BЋE 0A< v^€* Ш1ۀ^Ã݃$9uƒ$ Ш\TX # 1щ $_\$$H`$*}DžhDžpDžtDžlxE<8:>ULg€a ШDžt}]L&Rw$` CSD$$E\E$x` $jEU | $T}9}t E$ADžlx]}<:+Džlq⃅hD$/`$`.t]D$.`<$=.t1щ $˃t$$Ë`$`]Ys] 1`у9ˉHp DžDDžLpD9Lt\`L t+< <  ШtL`LuՋL` D`Lۉ8`89LL;H4ti Džt]D$.` $7D$/`<$.8+EEE;EuE|" GDžpE]LlCɉElqtllx` t3u'3 €  Шtȃȋ`$qNj` $`1`эA`L$\<$`$hEۉ}E.7UtkE:tZ1эqMu9M|'m}9}}|$|$ՀU|T$|E)$JU$/1EEEM|9#H_|]d\$T$ $^5)HF$NjLD$`<$T$3D$D$L$L)HHT$8$D$7`1 $7t`LL1򮃅tуHkE@ED$|$I|1ۃvuEtUL'€" ШtٍE\$D$M $E@ML$|<$~|g^҉](1щ $<~T$$AD$\$d~\-7U 2AЉ< 1ۍ҃M\B1B< vd1щ $}dL$$~`9p. DL`1уH6d\$<$D$>X`1щ $}`T$$$|'ǍX`t8t1'tL €  Шu$ t tu'C]'''\''붍^d]D$D$$$E$|Ef 0 ^d]T$D$$$$ME@UT$| $||eE@ML$|<${|1}Sу9v ]UTPU]D$D$P $Eb>t$>t$D$D$P$UEwD$&$ . 1$z1ɉ; Dž<E:<&<\9<:<2<;=|<$<5=luUFEE])$yE\$u$t$9ED1UэYM]9M|'m}9}}|$|$yU|T$|E)؉$TE$9D$ED$U$U E'ƒ" ШmfD$E$x9$ $<9D$<$  Vuw8Fωu랉9sY> Vtt2:tf $|t|$Dž|;]} Vщ룋Ut E$Et U$1|UED$D$$UWVSEED$D$$Dž|E|$$D$-t~E%=E1ۋUxދE11 ux;x<${Dž|E$|Č[^_]|t҉<$0E$|Č[^_]É<$ EDž|$w|Č[^_]É$..txD$<$T$E<$}EtE 19t4=E 19t> u18)E 9v" 9v> u8t9w1.$}'|D$D$E$t))EUt$<$T$<$UWVSLU}EED$A$\$>E%9U@g5%EE+]9}{UC}W}t :UD$EE܉$1UE܃эD ;%E}uE륉U}؉|$EԉD$U$}ԉ<$oE$Et U$REL[^_]Ë]t E$5 L[^_]ÉT$EE܉$$@1UEэD >E܉}U҉Et }<$E$Ǎ@w)EEMu8,[^_]Å.t}u녋E$rjE011ۉE}щ<$D$ T$L$調Dž.tE$.zE0؉E}щ<$D$ T$L$\Ǎ@v8U1WVS,EE}U 1эqxd;u |]1ۋE E9}JED$ )؉D$E؉D$E$Ǎ@w(EE];] |E,[^_]Å.tEtߋE$tӉ]ΐUWVS t8uD1ۋE1Uى $gۉu/ED$$ [^_]1эY뫉t$$]ED$$K [^_]U1WVS]t%;~t(щ $!g\$$ [^_]C ;1/uED>t}t84$Ѕt-Eډ$xE4$1<$)E[^_]E4$诿t%4$UG$-E E뾡u64$ӿEu1щ $e\$$E뷉4$Ѕ.tEډ$E<$ljUWVS\EED$~$̶}1уM $BeE\ EЋ}1UEуME<~ ШuyMЅtlEE9E}]U1:tFM}M1E\$щ$L$衻UЋuǃEM9M|}ԉ}܋EE܉E;E9E}܉D$E|$E$ɾ}L 1U}Eу9MM}]u>/tUU1ۅt=E8t41׹T$4$уL$ߺtEu΃EU9U|M ME$c}ËE|$D$$ ;$}=$d1эQMDU;ENEt$E$B}}4$}!E܋ME $PUD$ycE}M: $PUD$ScE1уMM؉MJEUE\[^_]1}YUEtVD$ D$ $) D$ D$ $] D$ D$ $}h D$ D$ $)J D$ D$ $]. D$ D$ $} Up U~p ]UWVST u u l ut$E$衧1[^_]Ét$$脧  \$]t)[^_]DžX[DžTDžP@ H=\<|$H$WtCPTPt\;Pt:HuPu\9;X)TDžP뇃}DžX{DžX( ۉ.1 hH $eáH $Vhp $dDž`5$ `D$ D$hD$D$$Ѳ$TU1ɉt*!u.Ht .>u!@u"uM1UurEuawEU8.u݋..tՃ\uz..tɿt&q1Džp| $n$땉$跲v끀{.dt&edB<.KzA&U$T$pM 4$L$ZhD0/\$h$:ED$t$$#x;4$ D$xX/z.m4$̱$ıUWVSEU1}у|uEYEļ[^_]ËU|1|:/1xE8 U u$ t1t.tE185tE<1򮋕|эL $谫:}$|$ײxt |/}D$|x$衲EuU$T$D$训TE%=@A1у /D:1.]\$|$$LuE%=@tjEu$EY E;MY.E[^_]UWVSUEE EUt<.uU|]u㡀  t; t.E8uUt$$T$Хu؋E<uG}EtUtUU[D^_]UWVSÃ,UE 8(E $UE.C߃v,[^_]$q ?} $|UXM]9Mt];]FE ;]UT$ڋM܉<$L$EuՋED$؋UT$M $Uau,1[^_]Ã*} $|U];]7@E"M1}.u;] UT$ڋM܉<$L$EEtEED$؋UT$M $Ut/9].tED$UT$E $؋U\EP];].]E E} ;u$|UU<$ƍ@T$D$ڋEuÃ;]v;u.&;u.MUE 1U$T$跤MM1҅ƒ,[^_]ËML$ED$؋U$Uy.;]v[ED$UT$M $UE=1҅7ML$ED$U$UE1҅ UWVS\EUUE҉UE… кE 9EUEU8ۋDXt 襜ӋE19EsU:E t E8(?x*E֥ڋDX?;4u(EE 9EUE19EtEtE8/t\[^_][[\\uU 9U.tEu:E9ЉE.wE;ۋDXt 訛EڋDXx949.XE+9t&.=M/.(U1.U9U.Ex/.ECփƒ? Шu@ƒ! ШOUE9UtD$ E UD$ET$$UHE9E Ш.kU1.t!U9U.LEtEx/.8UEUԈEt"貣]ӉDXt UӋUUӀU/}U҉$xЉE]}̋Eԅu1EU:<.UEEԋEUԉ:x=9x]/EhUZDXt PEӃEUgUUԉ1}[FEEUEU֋UB<:u~]u+]ԉ$ęECUD$Eĉ$D$谘EDUӉU8 q :uD$Eĉ$uԅ $|r '诟U1ۋPu_>u؉E}tdFEԉuUĉ$%EUUUԉ;9Yې9IEE럃E}mEԃE)]tb\tEԀ8.Eԋuȅ~\..U [Uԉu2<=<: Шu.uE뻃mUӍr#EP]̋Eԅ1E 19E.U1.t!U9U.EtEx/.U?Uƒ* ШEEA*Et E8(U 9U_E?Eƒ* ШtT1/E.?Et U:(?u.EE19EvU:kU 9UU1\tE0Et )Dxt 薓֋Em9E.mU׉U؉uuBEМU2Dp 8U9tEE9E. [uEt$Ex(t$q D$衒EU$UD$E D$Eu1U;E끋uU9s1EU D$ T$EUD$؉$0.t;urϋEU $EE EUU;u[.9EtJ藛U2DptQU9?ƒ* 1ҨU;E1EÉ;u-U\PUP UPUPۚUP ȚUP 赚UP袚UP nu0EU D$ T$EUD$؉$.;ur˺HUP0UP UPUPUWVS] uEۉE… Шt [^_]1эTэL1M [^_]U1ɉ9t!  D$ $ 踏UW1VSUEEEt4;M8[tyt&)(t&Dt Yًu1[^_]Ã]|Yu݋U 1}|tōA̓)YuYuEm믅u-AY!]ƒ^ ШtMvq:ƒ. Шu =YSYuHY=Et-E9A>u$E!YE ;MY.E[^_]UWVSUEE EUt.uU|]u㡀  t: t-E9uUt$$T$苑uًE uϋG}EtUtUU[D^_]UWVSÃ,UE 8(t8$UE2C߃v,[^_]$r Ã?t&} $|Ue]ƋE9Et];]VU ;]ED$U<$T$ڋE|uՋED$UT$E$؋UZu,1[^_]Ã*} $|U];]1PU"E1}.u;]ED$U<$T$ڋEEtEED$UT$E$؋Ut/9].tUT$ED$E $؋Ux\EP];].SU U܋} ;u$|UډƋE<$D$FD$EuÃ;]vv;u.;u.UE U2UU$T$UU21҅UT$ED$؋U$Ux.;]XED$UT$E$UE=1҅4UT$ED$U$UE1҅%UWVS|E܉U؋U܋E҉UЉE… кE 9EEUEEUȋUEăUỦEEEUԋEUE19EsUЋ:E t Eԃ8(8?wf*Eu79u$E E9ErE19EtEtEЃ8/t|[^_]É<$#t<$Lj9ؐ벃[ \uE 9E.tEtUԋ9‰U.wE؉E9c$軍 $[.aU/.L.EE9E.0UЃz/Cփƒ? Шu@ƒ! ШU܋E9UtD$ E UԉD$E؉T$$UЉE9E Ш..Et!U9U.~EtEЃx/.jUEU}Uԋ!ƒ^ ЃEt EԃEUUƃ[u\EtEUEE]]_U:EU1/Eq-4E]&\ӉEEt EEӅ2[|EuzڋEӋ8EE]Euh U$`/E$ <$>0<$ޅ%$!v$i<$<$O<$苅EB<$ˊ<$k9TUExڋEH]*]Eu1EU=tp:.UE1UUEUUU:.xUEUE\]Qz=uz ]uE)UBE9EEEۉE>ud1}[2EԅEHU}EBt:t>uuE}ۉ.t].EF{]u+u4$脇E[F<$D$ED$sUD2U$n uED$n $貅EED$n $藅EtEn EEE$8qF$ӆEE$NEVD$ ET$UD$$苉E$贋EUU}t_C{ EU$荋4$4$蠂$$胂EvE&뚋U$džƋE$E^EUEt$$誁u }_/E"EmU2(]t\\EtU .U~A.NE[Eu=ƒ: Шu.uÃv뻋UEF1?E 19E.y.Et!U9U.\EtEЃx/.HUԋ?Uԉƒ* ШEEF*Et Eԃ8(U 9UUԋ?Uԉƒ* Ш1/E.?Et Uԃ:(u?u.EE19EqUЋ:gB$谅UB$JE$:E.LE;Et$$E$E 9E\EtUԋEusߋE؃m9E.UӉU[t`EuE98tSEU9UrݺUЋ$τtҋUЋ$n9Ɖ$貄t$VtEt#Uԃz(t$n D$nEU T$U؉D$Eԉ$E!Z1]ЋU9s1EU D$ T$EԋU؉D$$.tƃ;]rϋEԋU $cEE E}[.WEt&uE98v9UЋ$袃t܋UЋ$A~9Ѓ?ƒ* 1Ҩ@+]0EU D$ T$EԋU؉D$$.;]r˺UWVS} uEE… Шt [^_]É<$蒃4$臃ډE [^_]UWVS]} u蚅tE\$D$$ wt$|$$_[^_]ÍE|$D$$w E$ԅ뼉t$ED$E$ËE$诅E$褅[^_]ÐUWVS,E]EU 1U؉уۉM1;u>r@\BvpM )U܋9ׅ9;u}؋E$胅tU<\tML$ E܉D$U؉$T$萁Bw,[^_]Í$zM ËMEQEEUD$ E܉$D$ED$%|$k,[^_]ËuEM 뷋U UWVS<]u… ШEEE $~E$~EyEE`OEEEЃEE9EEUԋMDE܋]tuЅU$迃tpt<\u E\땍MED$L$ t$$EЋEЃ{E$U܉$M<[^_]ÍUMD$T$ t$ $뢃E`E }}؉|$U$3.tE|$M܉ $tbE܋UԋEMDE܋]tuЅU M tWM Eԃ<[^_]ËM $'EA$ E܉$UM܉ $롐UWV} EuEU҉uEUu9v^Eu 9}v'1EMɉUt؃ڃ^_ÍvEǃui;uw U19Ur¿뻍v}u11E1uEEu떍v؃UTރE8 )EUEM ‰eUMEM Ɖu։eE9w;E OUWV0} EEEuEU#M҉MẺU܉u؉}u=9űEUtE؉EEEUMHEUU9Uv0uUEUEUMt ؃ډEU0^_ÐE܉ƃM9MwE9ErMԋU+UM܉U؉MԋEtE؋UԉEUMEUQhE̅u 1ủE̋EԋUűE؉Uu؃ރE )EЋU܉E̊M ‰ẻU܊MЋU}ԉE؊M lj}ԉu܉Uee;Uԉwu ;Ev+}U܋EMԋE)щMԉʊME ‹EUErUWVUu} E҉uEUu9vMEu 9}v1EU^_ÐEǃuM;uw U19UrҿˍvEu11E1uEEuU^_Ð )EUEM ‰eUMEM Ɖu։eE9w?;E6O0UWV0UE׍MƋU EEEME܉Uu>9MɉUtE܉EEEUMHEU0^_É;}vUM̉UMEUEU0^_ǃEua9}w9urŰE)E܉ŰUtE܋ỦEUMEUQ녅u 1ƋẺE܉U= +EԉE؉MMM׊M؋U E̊ME̊M؋E ẺE̊MUe;ỦEw uE9Ev M)MȋEM̋E+EщM̉ʊMMԉE ‹EUEUWVS [N2rE)19s׉M)F9Ήr [^_ÉUWVS[ñM) pNu. [^_ÐUSR   vЋuX[US[KMPv}Y[debuggerdump-po-stringsdump-stringshelpnoeditingnoprofilenorcposixprotectedrcfilerpm-requires~/.bashrcrbashBASH_ENVrun_wordexp%u %u --wordexp0 0run_one_command-cI have no name!GNU long options: --%s Shell options: -%s or -o option i686-redhat-linux-gnuGNU bash, version %s-(%s) POSIXLY_CORRECT\s-\v\$ > POSIX_PEDANTICPS1PS2EMACS*term*/etc/profile~/.bash_profile~/.bash_login~/.profileFUNCNAMEBASH_SOURCEBASH_LINENOmain%c%c: invalid option??host??emacsdumb%s: invalid option%s: is a directory/usr/local/lib/bashdb/bashdb-main.incUsage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... -irsD or -c command or -O shopt_option (invocation only) Type `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. Use the `bashbug' command to report bugs. %s: option requires an argument%s: cannot execute binary fileuetimed out waiting for input: auto-logout PROMPT_COMMAND/%s etermTMOUTreader_loop-p&&||>><&>&;;<<-<<<&>>|thenelseeliffiesacforselectwhileuntil[[readline stdin%s.%dHOME%a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M ; syntax error near `%s'syntax error ;|&PIPESTATUS-nexpected `)'"$@"parser stack overflowUse "%s" to leave the shell.   !"#$&'(),-/02479:<=>?@ABCEFGHIVWXYZ,OPUPPYZ4 !"#$&()/011PP:9;,-S*+.+,-TY,QRXU+U2T+U4UY511359UUWWUYP*+,U2PPUU2PP5>DUWW*+YJUUUUUKLMU2P8TP322OU8OU;DPPRRRRR %LU 4NPPTU3PPOORT3D*+,% N.53U233UPUUU5PU2PP2JPUPP3OOP33 !c"#$%&'()*+,-.56tufp7/v23RRRRRRRRRZRRRRR4RRf^RSRRC677778899999999999999999999999999999:::;;<<====>>>>>>>>>>>????????@@@@AAAAAABBBCCCDDEFFFGHIJJJKKLLLLMMNNOPPQQQRRRRRRSSTTTUUVVVWWWWWXXXXXXYYZZ  zzz%&Zzz'*,-0:41/65789|jzzzz  "# %+(.uvzz}~zxwyz{iktzzzzzzz[z !$ YU)zzzzzzzzzzzSRzzVmnl_zzzzEFzzzz23TPXopqrsOe`Mg;z<GzHQWzzzzfNz=>zzCDIJ\zhabzzzzz^cdAB]?@KL<=@b10|PQ]^T9Uwy:~szRqV 48mnos;{>Bsss?Ckss NsOs11SWXs'( ghsYijZbs[11\demnogh_11xr}mno`  "!#$)   % & *,a+- A l mno s   s DEFGHIJKLM $:..5589;,>1 3 1,A+,-,c22,,gh,k44244.,,x22|},l2,rijj2z{,2,*+2,121,-+,-+++,-4533 !"#$&'()/0 !"#$&'()55/0   %*+,33%33 33" !"#$3&'()3,-/024  !"#$&'()+,-/024  !"#$&'(),/024  !"#$&'()/024  !"#$&'()/024  !"#$&'(),/024  !"#$&'()/024 !"#$&()/0,*451+0/2.3  !"#$%&'()- R$+RR.31!R+RCKWZ_rwRRRRRRRRRRRRRRRRR{bR)?RRjR)ReqRRRRRRRRRRRRRRRRRRRRRRRRRRRRR)RRRRRRRRR?RR"R)RRRRRRRRRRRRRRRRRRjj)RRRRRR,RR-6RRRR"RR)RRRjjjjjRRRRRRRRRRRjRR"R RRRRRRR RRRLRRRRRRRRRRRRRRR\RRRRRRhjjjRRRjRRRRRRRj!RR" RRRRROOOOOOOOaa)Ba8aBcj3a855T=C=6z@]@A@@?=m=fH=HGGGkG<<t<K<!<;;;A@9x9G9988??p?Y?B?+??>>>>>n>a>T>G>*> >>=====HH7`87K;:: GFFlF0FEhEEDFDCCeC"CBBBBcBIB$BBAAcKUK1KKJ5JJJKK5KxKLK53I5I5JIIIkI^I55OI@IjJ55KJi5+JyJArANA99!= =<|:$::9:4=syntax error: unexpected end of filesyntax error near unexpected token `%s'unexpected EOF while looking for matching `%c'unexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'unexpected EOF while looking for matching `)'syntax error in conditional expressionunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token `%s', expected `)'unexpected token %d in conditional commandunexpected argument `%s' to conditional unary operatorunexpected argument `%s' to conditional binary operatorunexpected argument to conditional unary operatorunexpected token `%s', conditional binary operator expectedunexpected argument to conditional binary operatorconditional binary operator expectedgetcwd: cannot access parent directories`%s': not a valid identifier/dev/ttyOLDPWD=~:~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZsyntax error: arithmetic expression requiredmake_here_document: bad instruction type %dmake_redirection: redirection instruction `%d' out of rangesyntax error: `((%s))'syntax error: `;' unexpectedexecutable(%s) clean_simple_commandEihh#ihhhhhhEi4iEihhhhhhPS4%s=(%s) ''%sfor %s in select %s in case %s in [[ ]] ! ''(( )) %u<<< %s<<%s%s >>%s<%s%d>&%s-%d<&%s-%d>&%d-%d<&%d-%d>&%s%d<&%s>|%s<>%s%d>&-%d>&%d%d<&%d ) && || case %s in print_commandtime -p for (({ function %s () { } if then | else %c() do cprintf: `%c': invalid format characterprint_command: bad connector `%d'wwwPwvvyxvxxxsxXx=x$x xww~vdyi )~`~?XXX0ڈʈ0dispose_command/dev/nullexecute_cond_nodeeval_builtinbuiltin_envreturn_temp_envELF%s: %s: bad ELF interpreter%s: %s: bad interpreterloop_redirectionsexecute_commandauto_resumesimple-commandfg%s: command not foundsaved redirectssaved_redirects%s: readonly functionbgsubstringexactfunction_callingexecute-shell-functionreal %2R user %2U sys %2S real %3lR user %3lU sys %3lSPS3LINESCOLUMNS%*d%s%s#? execute_connectionpipe-file-descriptorspipe errorȤXס[2cannot redirect standard input from /dev/null: %scannot duplicate fd %d to fd %d%s: restricted: cannot specify `/' in command namesTIMEFORMAT: `%c': invalid format characterGLOBIGNOREHISTCONTROLHISTFILESIZEHISTIGNOREHISTSIZEHISTTIMEFORMATHOSTFILEIFSIGNOREEOFLANGLC_ALLLC_COLLATELC_CTYPELC_MESSAGESLC_NUMERICMAILMAILCHECKMAILPATHOPTERROPTINDTERMCAPTERMINFOTEXTDOMAINTEXTDOMAINDIRTZhistcharsignoreeof%s=PPIDshell-initSHLVL_=BASH_ARGVBASH_ARGCHISTFILEignorespaceerasedupsignoredupsignoreboth/usr/local/bin:/bin:/usr/bin+ i686HOSTTYPEOSTYPEMACHTYPEHOSTNAME60060BASHBASH_VERSIONBASH_VERSINFO~/.sh_history~/.bash_history500EUIDSECONDSBASH_COMMANDBASH_SUBSHELLRANDOMHISTCMDCOMP_WORDBREAKSDIRSTACKGROUPSBASH_EXECUTION_STRING() {make_local_variable: no function context at current scopeshell level (%d) too high, resetting to 1all_local_variables: no function context at current scopepop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables contextpop_scope: head of shell_variables not a temporary environment scopeerror importing function definition for `%s'L&L&L&L&&L&Z&Z&&Z&L&L&L&L&L&Z&Z&L&L&j('()$*j(y(((()K)[))bash-maintainers@gnu.orgunknown command errorbad command typebad connectorbad jump%s: line Aborting...last command: %s (null)%s: warning: %s: %s:%s%d: %s: %s: %d%s: unbound variable%s: readonly variablerecursion stack underflowsyntax error in expressioninvalid arithmetic basevalue too great for base*/%+-&^|missing `)'exponent less than 0division by 0bug: bad expassign tokenexpression expected%s%s%s: %s (error token is "%s")expression recursion level exceededidentifier expected after pre-increment or pre-decrementsyntax error: operand expectedattempted assignment to non-variable`:' expected for conditional expressionNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN[%d] %ld Signal %d[%d]%c |Stopped%*sStopped(%s) (wd: %s)%5ldRunningDone &Unknown status(core dumped) Exit %dDone(%d)[%ld: %d] tcsetattrnotify_of_job_status(wd now: %s) %s: line %d: (core dumped)SIGCHLD trapno job control in this shell (wd: %s)%s: job has terminatedjob-working-directorystart_pipeline: pgrp pipeforkchild setpgid (%ld to %ld)describe_pid: %ld: no such piddeleting stopped job %d with process group %ldinitialize_job_control: setpgidinitialize_job_control: getpgrp failedwait_for: No record of process %ld%s: job %d already in backgroundwait_for_job: job %d is stoppedwait: pid %ld is not a child of this shell$($[command substitution#%:-=?+/}%:=+/%s: bad substitution%s: substring expression < 0%s: parameter null or not set<(>(process substitutionno match: %sS........DS...................9S..........................cLM@@@@@@@@XM@@@@@@@@@@@@@@@@@@@iM@@@@@@@@@@@@@@@@@@@@@@@@@@bu]P6g4444 4444400000000004444444444444444444444444444444C4444444444444444444444444444444bad substitution: no closing `%s' in %s%s: cannot assign list to array membercommand_substitute: cannot duplicate pipe as fd 1cannot make child for command substitutioncannot make pipe for command substitution$%s: cannot assign in this waycannot make pipe for process substitutioncannot make child for process substitutioncannot duplicate named pipe %s as fd %dThe mail in %s has been read You have mail in $_You have new mail in $_EXITSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMSIGJUNK(16)SIGCHLDSIGCONTSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYSSIGJUNK(32)SIGJUNK(33)SIGRTMINSIGRTMIN+1SIGRTMIN+2SIGRTMIN+3SIGRTMIN+4SIGRTMIN+5SIGRTMIN+6SIGRTMIN+7SIGRTMIN+8SIGRTMIN+9SIGRTMIN+10SIGRTMIN+11SIGRTMIN+12SIGRTMIN+13SIGRTMIN+14SIGRTMIN+15SIGRTMAX-14SIGRTMAX-13SIGRTMAX-12SIGRTMAX-11SIGRTMAX-10SIGRTMAX-9SIGRTMAX-8SIGRTMAX-7SIGRTMAX-6SIGRTMAX-5SIGRTMAX-4SIGRTMAX-3SIGRTMAX-2SIGRTMAX-1SIGRTMAXDEBUGRETURNinvalid signal numberSIGexit trapinterrupt traptrap_handler: bad signal %ddebug traperror trapreturn traprun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselfsave_bash_input: buffer already exists for new fd %dcannot allocate new file descriptor for bash input from fd %dijjjjjjjjiijjjjjjjjjjjjjjjjjjjiijjjjjjjjjjjjjjjjjjjjjjjjjjiiiargument expected/dev/fd/%s: binary operator expected`)' expected, found %s%s: unary operator expected`)' expectedmissing `]'too many arguments%s: integer expression expectedvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvxxxy5yxxg}g}g}g}g}`=g}g}g}g}g}g}g}g}g}g}g}g}g}g}g}g}~~~~~+ g}g}g}g}v`e~g}X~*~}}g}}}g}v}džK@(#)Bash version 3.00.15(1) release GNUCopyright (C) 2004 Free Software Foundation, Inc. release3.00%s.%d(%d)-%s%s.%d(%d)GNU bash, version %s (%s) ;|&( ;|&()bad array subscript'()'%s[%s: %s[%s]: %sarray assign%s: cannot assign to non-numeric index%s: cannot create: %s%s%s%sFIGNORE "'><=;|&(: "'@><=;|&(:#comment-begin$@Bashshell-expand-linehistory-expand-linemagic-spacehistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-history'" \"'@<>=;|&()#$`?*[!:{$include hostname_completion_file/etc/hosts%s %dC-xC-e;|&{(`()<>;&| symlink-hook "'bash_execute_unix_commandno closing `%c' in %s%s: missing colon separatorfc -e "${VISUAL:-${EDITOR:-vi}}"fc -e "${VISUAL:-${EDITOR:-emacs}}"bash_execute_unix_command: cannot find keymap for command%s: first non-whitespace character is not `"'/usr/share/localePOSIX"" #: %s:%d msgid %s%s msgstr "" /dev/tcp/*/*/dev/udp/*/*file descriptor out of range%s: ambiguous redirectsh-thd%s: restricted: cannot redirect outputcannot create temp file for here document: %s%s: cannot overwrite existing fileredirection error: cannot duplicate fd+! +! +! +! V V V V V V +! +! +! +! +! V V +! +! % % % % @( @(  %  % @( ( % % % % %  %  % a3 ~3 ~3 a3 ~3 ~3 q3 a3 ~3 q3 a3 ~3 a3 q3 a3 COMP_LINECOMP_POINTCOMP_WORDSCOMP_CWORDCOMPREPLYcompletion: function `%s' not foundprogcomp_insert: %s: NULL COMPSPECxmalloc: cannot allocate %lu bytes (%lu bytes allocated)xrealloc: cannot reallocate %lu bytes (%lu bytes allocated)Display the possible completions depending on the options. Intendedto be used from within a shell function generating possible completions.If the optional WORD argument is supplied, matches against WORD areFor each NAME, specify how arguments are to be completed.If the -p option is supplied, or if no options are supplied, existingcompletion specifications are printed in a way that allows them to bereused as input. The -r option removes a completion specification foreach NAME, or, if no NAMEs are supplied, all completion specifications.printf formats and prints ARGUMENTS under control of the FORMAT. FORMATis a character string which contains three types of objects: plaincharacters, which are simply copied to standard output, character escapesequences which are converted and copied to the standard output, andformat specifications, each of which causes printing of the next successiveargument. In addition to the standard printf(1) formats, %b means toexpand backslash escape sequences in the corresponding argument, and %qmeans to quote the argument in a way that can be reused as shell input.Toggle the values of variables controlling optional behavior.The -s flag means to enable (set) each OPTNAME; the -u flagunsets each OPTNAME. The -q flag suppresses output; the exitstatus indicates whether each OPTNAME is set or unset. The -ooption restricts the OPTNAMEs to those defined for use with`set -o'. With no options, or with the -p option, a list of allsettable options is displayed, with an indication of whether orDisplay the list of currently remembered directories. Directoriesfind their way onto the list with the `pushd' command; you can getback up through the list with the `popd' command.The -l flag specifies that `dirs' should not print shorthand versionsof directories which are relative to your home directory. This meansthat `~/bin' might be displayed as `/homes/bfox/bin'. The -v flagcauses `dirs' to print the directory stack with one entry per line,prepending the directory name with its position in the stack. The -pflag does the same thing, but the stack position is not prepended.The -c flag clears the directory stack by deleting all of the elements.+N displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero.-N displays the Nth entry counting from the right of the list shown byRemoves entries from the directory stack. With no arguments,removes the top directory from the stack, and cd's to the new+N removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second.-N removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last.-n suppress the normal change of directory when removing directories from the stack, so only the stack is manipulated.You can see the directory stack with the `dirs' command.Adds a directory to the top of the directory stack, or rotatesthe stack, making the new top of the stack the current workingdirectory. With no arguments, exchanges the top two directories.+N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with-N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with-n suppress the normal change of directory when adding directories to the stack, so only the stack is manipulated.dir adds DIR to the directory stack at the top, making it the new current working directory.BASH_VERSION Version information for this Bash.CDPATH A colon separated list of directories to search when the argument to `cd' is not found in the currentGLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion.HISTFILE The name of the file where your command history is stored.HISTFILESIZE The maximum number of lines this file can contain.HISTSIZE The maximum number of history lines that a runningHOME The complete pathname to your login directory.HOSTNAME The name of the current host.HOSTTYPE The type of CPU this version of Bash is running under.IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input.MACHTYPE A string describing the current system Bash is running on.MAILCHECK How often, in seconds, Bash checks for new mail.MAILPATH A colon-separated list of filenames which Bash checksOSTYPE The version of Unix this version of Bash is running on.PATH A colon-separated list of directories to search whenPROMPT_COMMAND A command to be executed before the printing of eachPS1 The primary prompt string.PS2 The secondary prompt string.PWD The full pathname of the current directory.SHELLOPTS A colon-separated list of enabled shell options.TERM The name of the current terminal type.TIMEFORMAT The output format for timing statistics displayed by theauto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job.histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'.HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list.Returns a status of 0 or 1 depending on the evaluation of the conditionalexpression EXPRESSION. Expressions are composed of the same primaries usedby the `test' builtin, and may be combined using the following operators ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else falseWhen the `==' and `!=' operators are used, the string to the right of theoperator is used as a pattern and pattern matching is performed. The&& and || operators do not evaluate EXPR2 if EXPR1 is sufficient todetermine the expression's value.The EXPRESSION is evaluated according to the rules for arithmeticevaluation. Equivalent to "let EXPRESSION".This is similar to the `fg' command. Resume a stopped or backgroundjob. If you specifiy DIGITS, then that job is used. If you specifyWORD, then the job whose name begins with WORD is used. Following thejob specification with a `&' places the job in the background.Run a set of commands in a group. This is one way to redirect anCreate a simple command invoked by NAME which runs COMMANDS.Arguments on the command line along with NAME are passed to theExpand and execute COMMANDS as long as the final command in the`until' COMMANDS has an exit status which is not zero.`while' COMMANDS has an exit status of zero.The if COMMANDS are executed. If the exit status is zero, then the thenCOMMANDS are executed. Otherwise, each of the elif COMMANDS are executedin turn, and if the exit status is zero, the corresponding then COMMANDSare executed and the if command completes. Otherwise, the else COMMANDSare executed, if present. The exit status is the exit status of the lastcommand executed, or zero if no condition tested true.Selectively execute COMMANDS based upon WORD matching PATTERN. The`|' is used to separate multiple patterns.Execute PIPELINE and print a summary of the real time, user CPU time,and system CPU time spent executing PIPELINE when it terminates.The return status is the return status of PIPELINE. The `-p' optionprints the timing summary in a slightly different format. This usesthe value of the TIMEFORMAT variable as the output format.The WORDS are expanded, generating a list of words. Theset of expanded words is printed on the standard error, eachpreceded by a number. If `in WORDS' is not present, `in "$@"'is assumed. The PS3 prompt is then displayed and a line readfrom the standard input. If the line consists of the numbercorresponding to one of the displayed words, then NAME is setto that word. If the line is empty, WORDS and the prompt areredisplayed. If EOF is read, the command completes. Any othervalue read causes NAME to be set to null. The line read is savedin the variable REPLY. COMMANDS are executed after each selectionuntil a break command is executed.EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression isomitted, it behaves as if it evaluates to 1.The `for' loop executes a sequence of commands for each member in alist of items. If `in WORDS ...;' is not present, then `in "$@"' isassumed. For each element in WORDS, NAME is set to that element, andWait for the specified process and report its termination status. IfN is not given, all currently active child processes are waited for,and the return code is zero. N may be a process ID or a jobspecification; if a job spec is given, all processes in the job'sThe user file-creation mask is set to MODE. If MODE is omitted, or if`-S' is supplied, the current value of the mask is printed. The `-S'option makes the output symbolic; otherwise an octal number is output.If `-p' is supplied, and MODE is omitted, the output is in a formthat may be used as input. If MODE begins with a digit, it isinterpreted as an octal number, otherwise it is a symbolic mode stringlike that accepted by chmod(1).Ulimit provides control over the resources available to processesstarted by the shell, on systems that allow such control. If anoption is given, it is interpreted as follows: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -c the maximum size of core files created -d the maximum size of a process's data segment -f the maximum size of files created by the shell -i the maximum number of pending signals -l the maximum size a process may lock into memory -m the maximum resident set size -n the maximum number of open file descriptors -q the maximum number of bytes in POSIX message queues -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memory -x the maximum number of file locksIf LIMIT is given, it is the new value of the specified resource;the special LIMIT values `soft', `hard', and `unlimited' stand forthe current soft limit, the current hard limit, and no limit, respectively.Otherwise, the current value of the specified resource is printed.If no option is given, then -f is assumed. Values are in 1024-byteincrements, except for -t, which is in seconds, -p, which is inincrements of 512 bytes, and -u, which is an unscaled number ofFor each NAME, indicate how it would be interpreted if used as aIf the -t option is used, `type' outputs a single word which is one of`alias', `keyword', `function', `builtin', `file' or `', if NAME is analias, shell reserved word, shell function, shell builtin, disk file,If the -p flag is used, `type' either returns the name of the diskfile that would be executed, or nothing if `type -t NAME' would notIf the -a flag is used, `type' displays all of the places that containan executable named `file'. This includes aliases, builtins, andfunctions, if and only if the -p flag is not also used.The -f flag suppresses shell function lookup.The -P flag forces a PATH search for each NAME, even if it is an alias,builtin, or function, and returns the name of the disk file that wouldThe command ARG is to be read and executed when the shell receivessignal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPECis supplied) or `-', each specified signal is reset to its originalvalue. If ARG is the null string each SIGNAL_SPEC is ignored by theshell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0)the command ARG is executed on exit from the shell. If a SIGNAL_SPECis DEBUG, ARG is executed after every simple command. If the`-p' optionis supplied then the trap commands associated with each SIGNAL_SPEC aredisplayed. If no arguments are supplied or if only `-p' is given, trapprints the list of commands associated with each signal. Each SIGNAL_SPECis either a signal name in or a signal number. Signal namesare case insensitive and the SIG prefix is optional. `trap -l' printsa list of signal names and their corresponding numbers. Note that asignal can be sent to the shell with "kill -signal $$".Print the accumulated user and system times for processes run fromThis is a synonym for the "test" builtin, but the lastargument must be a literal `]', to match the opening `['.Exits with a status of 0 (true) or 1 (false) depending onthe evaluation of EXPR. Expressions may be unary or binary. Unaryexpressions are often used to examine the status of a file. Thereare string operators as well, and numeric comparison operators. -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. -z STRING True if string is empty. STRING True if string is not empty. True if the strings are equal. True if the strings are not equal. True if STRING1 sorts before STRING2 lexicographically. True if STRING1 sorts after STRING2 lexicographically. -o OPTION True if the shell option OPTION is enabled. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge.Arithmetic binary operators return true if ARG1 is equal, not-equal,less-than, less-than-or-equal, greater-than, or greater-than-or-equalSuspend the execution of this shell until it receives a SIGCONTsignal. The `-f' if specified says not to complain about thisbeing a login shell if it is; just suspend anyway.Read and execute commands from FILENAME and return. The pathnamesin $PATH are used to find the directory containing FILENAME. If anyARGUMENTS are supplied, they become the positional parameters whenThe positional parameters from $N+1 ... are renamed to $1 ... If N isnot given, it is assumed to be 1.The given NAMEs are marked readonly and the values of these NAMEs maynot be changed by subsequent assignment. If the -f option is given,then functions corresponding to the NAMEs are so marked. If noarguments are given, or if `-p' is given, a list of all readonly namesis printed. The `-a' option means to treat each NAME asan array variable. An argument of `--' disables further optionNAMEs are marked for automatic export to the environment ofsubsequently executed commands. If the -f option is given,the NAMEs refer to functions. If no NAMEs are given, or if `-p'is given, a list of all names that are exported in this shell isprinted. An argument of `-n' says to remove the export propertyfrom subsequent NAMEs. An argument of `--' disables further optionFor each NAME, remove the corresponding variable or function. Giventhe `-v', unset will only act on variables. Given the `-f' flag,unset will only act on functions. With neither flag, unset firsttries to unset a variable, and if that fails, then tries to unset afunction. Some variables cannot be unset; also see readonly. -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the 1003.2 standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on -P If set, do not follow symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG trap is inherited by shell functions.Using + rather than - causes these flags to be turned off. Theflags can also be used upon invocation of the shell. The currentset of flags may be found in $-. The remaining n ARGs are positionalparameters and are assigned, in order, to $1, $2, .. $n. If noARGs are given, all shell variables are printed.Causes a function to exit with the return value specified by N. If Nis omitted, the return status is that of the last command.One line is read from the standard input, or from file descriptor FD if the-u option is supplied, and the first word is assigned to the first NAME,the second word to the second NAME, and so on, with leftover words assignedto the last NAME. Only the characters found in $IFS are recognized as worddelimiters. If no NAMEs are supplied, the line read is stored in the REPLYvariable. If the -r option is given, this signifies `raw' input, andbackslash escaping is disabled. The -d option causes read to continueuntil the first character of DELIM is read, rather than newline. If the -poption is supplied, the string PROMPT is output without a trailing newlinebefore attempting to read. If -a is supplied, the words read are assignedto sequential indices of ARRAY, starting at zero. If -e is supplied andthe shell is interactive, readline is used to obtain the line. If -n issupplied with a non-zero NCHARS argument, read returns after NCHARScharacters have been read. The -s option causes input coming from aThe -t option causes read to time out and return failure if a complete lineof input is not read within TIMEOUT seconds. If the TMOUT variable is set,its value is the default timeout. The return code is zero, unless end-of-fileis encountered, read times out, or an invalid file descriptor is supplied asEach ARG is an arithmetic expression to be evaluated. Evaluationis done in fixed-width integers with no check for overflow, thoughdivision by 0 is trapped and flagged as an error. The followinglist of operators is grouped into levels of equal-precedence operators.The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement !, ~ logical and bitwise negation *, /, % multiplication, division, remainder <<, >> left and right bitwise shiftsShell variables are allowed as operands. The name of the variableis replaced by its value (coerced to a fixed-width integer) withinan expression. The variable need not have its integer attributeturned on to be used in an expression.Operators are evaluated in order of precedence. Sub-expressions inparentheses are evaluated first and may override the precedenceIf the last ARG evaluates to 0, let returns 1; 0 is returnedSend the processes named by PID (or JOB) the signal SIGSPEC. IfSIGSPEC is not present, then SIGTERM is assumed. An argument of `-l'lists the signal names; if arguments follow `-l' they are assumed tobe signal numbers for which names should be listed. Kill is a shellbuiltin for two reasons: it allows job IDs to be used instead ofprocess IDs, and, if you have reached the limit on processes thatyou can create, you don't have to start a process to kill another one.By default, removes each JOBSPEC argument from the table of active jobs.If the -h option is given, the job is not removed from the table, but ismarked so that SIGHUP is not sent to the job if the shell receives aSIGHUP. The -a option, when JOBSPEC is not supplied, means to remove alljobs from the job table; the -r option means to remove only running jobs.Lists the active jobs. The -l option lists process id's in additionto the normal information; the -p option lists process id's only.If -n is given, only processes that have changed status since the lastnotification are printed. JOBSPEC restricts output to that job. The-r and -s options restrict output to running and stopped jobs only,respectively. Without options, the status of all active jobs isprinted. If -x is given, COMMAND is run after all job specificationsthat appear in ARGS have been replaced with the process ID of that job'sDisplay the history list with line numbers. Lines listed withwith a `*' have been modified. Argument of N says to list onlythe last N lines. The `-c' option causes the history list to becleared by deleting all of the entries. The `-d' option deletesthe history entry at offset OFFSET. The `-w' option writes out thecurrent history to the history file; `-r' means to read the file andappend the contents to the history list instead. `-a' meansto append history lines from this session to the history file.Argument `-n' means to read all history lines not already readfrom the history file and append them to the history list.If FILENAME is given, then that is used as the history file elseif $HISTFILE has a value, that is used, else ~/.bash_history.If the -s option is supplied, the non-option ARGs are appended tothe history list as a single entry. The -p option means to performhistory expansion on each ARG and display the result, without storingIf the $HISTTIMEFORMAT variable is set and not null, its value is usedas a format string for strftime(3) to print the time stamp associatedwith each displayed history entry. No time stamps are printed otherwise.Display helpful information about builtin commands. If PATTERN isspecified, gives detailed help on all commands matching PATTERN,otherwise a list of the builtins is printed. The -s optionrestricts the output for each builtin command matching PATTERN toFor each NAME, the full pathname of the command is determined andremembered. If the -p option is supplied, PATHNAME is used as thefull pathname of NAME, and no path search is performed. The -roption causes the shell to forget all remembered locations. The -doption causes the shell to forget the remembered location of each NAME.If the -t option is supplied the full pathname to which each NAMEcorresponds is printed. If multiple NAME arguments are supplied with-t, the NAME is printed before the hashed full pathname. The -l optioncauses output to be displayed in a format that may be reused as input.If no arguments are given, information about remembered commands is displayed.Place JOB_SPEC in the background, as if it had been started with`&'. If JOB_SPEC is not present, the shell's notion of the currentPlace JOB_SPEC in the foreground, and make it the current job. IfJOB_SPEC is not present, the shell's notion of the current job isfc is used to list or edit and re-execute commands from the history list.FIRST and LAST can be numbers specifying the range, or FIRST can be astring, which means the most recent command beginning with that -e ENAME selects which editor to use. Default is FCEDIT, then EDITOR, -l means list lines instead of editing. -n means no line numbers listed. -r means reverse the order of the lines (making it newest listed first).With the `fc -s [pat=rep ...] [command]' format, the command isre-executed after the substitution OLD=NEW is performed.A useful alias to use with this is r='fc -s', so that typing `r cc'runs the last command beginning with `cc' and typing `r' re-executesExit the shell with a status of N. If N is omitted, the exit statusis that of the last command executed.Exec FILE, replacing this shell with the specified program.If FILE is not specified, the redirections take effect in thisshell. If the first argument is `-l', then place a dash in thezeroth arg passed to FILE, as login does. If the `-c' optionis supplied, FILE is executed with a null environment. The `-a'option means to make set argv[0] of the executed process to NAME.If the file cannot be executed and the shell is not interactive,then the shell exits, unless the shell option `execfail' is set.Getopts is used by shell procedures to parse positional parameters.OPTSTRING contains the option letters to be recognized; if a letteris followed by a colon, the option is expected to have an argument,which should be separated from it by white space.Each time it is invoked, getopts will place the next option in theshell variable $name, initializing name if it does not exist, andthe index of the next argument to be processed into the shellvariable OPTIND. OPTIND is initialized to 1 each time the shell ora shell script is invoked. When an option requires an argument,getopts places that argument into the shell variable OPTARG.getopts reports errors in one of two ways. If the first characterof OPTSTRING is a colon, getopts uses silent error reporting. Inthis mode, no error messages are printed. If an invalid option isseen, getopts places the option character found into OPTARG. If arequired argument is not found, getopts places a ':' into NAME andsets OPTARG to the option character found. If getopts is not insilent mode, and an invalid option is seen, getopts places '?' intoNAME and unsets OPTARG. If a required argument is not found, a '?'is placed in NAME, OPTARG is unset, and a diagnostic message isIf the shell variable OPTERR has the value 0, getopts disables theprinting of error messages, even if the first character ofOPTSTRING is not a colon. OPTERR has the value 1 by default.Getopts normally parses the positional parameters ($0 - $9), but ifmore arguments are given, they are parsed instead.Read ARGs as input to the shell and execute the resulting command(s).Enable and disable builtin shell commands. This allowsyou to use a disk command which has the same name as a shellbuiltin without specifying a full pathname. If -n is used, theNAMEs become disabled; otherwise NAMEs are enabled. For example,to use the `test' found in $PATH instead of the shell builtinversion, type `enable -n test'. On systems supporting dynamicloading, the -f option may be used to load new builtins from theshared object FILENAME. The -d option will delete a builtinpreviously loaded with -f. If no non-option names are given, orthe -p option is supplied, a list of builtins is printed. The-a option means to print every builtin with an indication of whetheror not it is enabled. The -s option restricts the output to the POSIX.2`special' builtins. The -n option displays a list of all disabled builtins.Output the ARGs. If -n is specified, the trailing newline issuppressed. If the -e option is given, interpretation of thefollowing backslash-escaped characters is turned on: \num the character whose ASCII code is NUM (octal).You can explicitly turn off the interpretation of the above charactersCreate a local variable called NAME, and give it VALUE. LOCALcan only be used within a function; it makes the variable NAMEhave a visible scope restricted to that function and its children.Declare variables and/or give them attributes. If no NAMEs aregiven, then display the values of variables instead. The -p optionwill display the attributes and values of each NAME. -a to make NAMEs arrays (if supported) -f to select from among function names only -F to display function names (and line number and source file name if debugging) without definitions -i to make NAMEs have the `integer' attribute -t to make NAMEs have the `trace' attributeVariables with the integer attribute have arithmetic evaluation (see`let') done when the variable is assigned to.When displaying values of variables, -f displays a function's nameand definition. The -F option restricts the display to functionUsing `+' instead of `-' turns off the given attribute instead. Whenused in a function, makes NAMEs local, as with the `local' command.Runs COMMAND with ARGS ignoring shell functions. If you have a shellfunction called `ls', and you wish to call the command `ls', you cansay "command ls". If the -p option is given, a default value is usedfor PATH that is guaranteed to find all of the standard utilities. Ifthe -V or -v option is given, a string is printed describing COMMAND.The -V option produces a more verbose description.Return an unsuccessful result.No effect; the command does nothing. A zero exit code is returned.Print the current working directory. With the -P option, pwd printsthe physical directory, without any symbolic links; the -L optionmakes pwd follow symbolic links.Change the current directory to DIR. The variable $HOME is thedefault DIR. The variable CDPATH defines the search path forthe directory containing DIR. Alternative directory names in CDPATHare separated by a colon (:). A null directory name is the same asthe current directory, i.e. `.'. If DIR begins with a slash (/),then CDPATH is not used. If the directory is not found, and theshell option `cdable_vars' is set, then try the word as a variablename. If that variable has a value, then cd to the value of thatvariable. The -P option says to use the physical directory structureinstead of following symbolic links; the -L option forces symbolic linksReturns the context of the current subroutine call.Without EXPR, returns returns "$line $filename". With EXPR,returns "$line $subroutine $filename"; this extra informationcan be used used to provide a stack trace.The value of EXPR indicates how many call frames to go back before thecurrent one; the top frame is frame 0.Run a shell builtin. This is useful when you wish to rename ashell builtin to be a function, but need the functionality of thebuiltin within the function itself.Resume the next iteration of the enclosing FOR, WHILE or UNTIL loop.If N is specified, resume at the N-th enclosing loop.Exit from within a FOR, WHILE or UNTIL loop. If N is specified,Bind a key sequence to a Readline function or a macro, or seta Readline variable. The non-option argument syntax is equivalentto that found in ~/.inputrc, but must be passed as a single argument:bind '"\C-x\C-r": re-read-init-file'.bind accepts the following options: -m keymap Use `keymap' as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -r keyseq Remove the binding for KEYSEQ. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when -f filename Read key bindings from FILENAME. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -V List variable names and values -v List variable names and values in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input.Remove NAMEs from the list of defined aliases. If the -a option is given,then remove all alias definitions.`alias' with no arguments or with the -p option prints the listof aliases in the form alias NAME=VALUE on standard output.Otherwise, an alias is defined for each NAME whose VALUE is given.A trailing space in VALUE causes the next word to be checked foralias substitution when the alias is expanded. Alias returnstrue unless a NAME is given for which no alias has been defined.alias [-p] [name[=value] ... ]bind [-lpvsPVS] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]builtin [shell-builtin [arg ...]]command [-pVv] command [arg ...]declare [-afFirtx] [-p] [name[=value] ...]typeset [-afFirtx] [-p] name[=value] ...enable [-pnds] [-a] [-f filename] [name ...]exec [-cl] [-a name] file [redirection ...]fc [-e ename] [-nlr] [first] [last] or fc -s [pat=rep] [cmd]hash [-lr] [-p pathname] [-dt] [name ...]history [-c] [-d offset] [n] or history -awrn [filename] or history -ps arg [arg...]jobs [-lnprs] [jobspec ...] or jobs -x command [args]disown [-h] [-ar] [jobspec ...]kill [-s sigspec | -n signum | -sigspec] [pid | job]... or kill -l [sigspec]read [-ers] [-u fd] [-t timeout] [-p prompt] [-a array] [-n nchars] [-d delim] [name ...]set [--abefhkmnptuvxBCHP] [-o option] [arg ...]export [-nf] [name[=value] ...] or export -preadonly [-af] [name[=value] ...] or readonly -ptrap [-lp] [arg signal_spec ...]ulimit [-SHacdflmnpstuv] [limit]for NAME [in WORDS ... ;] do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donecase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donefunction NAME { COMMANDS ; } or NAME () { COMMANDS ; }variables - Some variable names and meaningsshopt [-pqsu] [-o long-option] optname [optname...]complete [-abcdefgjksuv] [-pr] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [name ...]compgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [word]generated.not each is set.top directory. zero) is at the top. directory. shell can access. for new mail. looking for commands. primary prompt. `time' reserved word.entire set of commands.function as $0 .. $n.Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) donethe COMMANDS are executed.pipeline are waited for. -p the pipe buffer size -s the maximum stack sizeprocesses.command name.or unfound, respectively.return `file'.be executed.the shell.File operators:String operators: -n STRING STRING1 = STRING2 STRING1 != STRING2 STRING1 < STRING2 STRING1 > STRING2Other operators:than ARG2.FILENAME is executed.processing. -o option-name by default.terminal to not be echoed.the argument to -u. -, + unary minus, plus ** exponentiation +, - addition, subtraction <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignmentrules above.otherwise.process group leader.anything in the history list.a short usage synopsis.job is used.string. then vi.the last command.Logout of a login shell.printed. \a alert (bell) \b backspace \c suppress trailing newline \E escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslashwith the -E option.Obsolete. See `declare'.The flags are: -r to make NAMEs readonly -x to make NAMEs exportname only.Return a successful result.to be followed.break N levels. KEYSEQ is entered.unaliasunalias [-a] name [name ...]breakbreak [n]continuecontinue [n]callercaller [EXPR]cdcd [-L|-P] [dir]pwdpwd [-PL]truefalsedeclaretypesetlocallocal name[=value] ...echo [-neE] [arg ...]enableevaleval [arg ...]getoptsgetopts optstring name [arg]exit [n]fg [job_spec]bg [job_spec]help [-s] [pattern ...]jobsdisownletlet arg [arg ...]readreturn [n]unset [-f] [-v] [name ...]shiftshift [n]sourcesource filename [arguments]. filename [arguments]suspend [-f]testtest [expr][ arg... ]timestype [-afptP] name [name ...]ulimitumaskumask [-p] [-S] [mode]waitwait [n]time [-p] PIPELINE{ ... }{ COMMANDS ; }%%[DIGITS | WORD] [&](( ... ))(( expression ))[[ ... ]][[ expression ]]pushdpushd [dir | +N | -N] [-n]popdpopd [+N | -N] [-n]dirs [-clpv] [+N] [-N]shoptprintfprintf format [arguments]compgen|} } ~  T~ ~ ~   h   <  Ѐ  d   4 p   , p    8 '_ l   @  ̅  '_ X  '_ ؆   `  '_  ܇  '_ P  Ј '_  T '_  ĉ  D '_  Ċ  '_  <  '_ x  '_  0 '_  P  Č   D h    < |   4 l    d      h 6  ܑ  @ |  H  @ x   ( `  Д  H    8 h   '_ L |   '_ <  И  8 |   <  Ě `  H x  ț   0 | Ȝ  `   ( T   ( p   ( h   ( h   0       T  ̢  X    0 p    D  Х  X x   '_ 0 X   ا  D t  Ԩ   , D x  ȩ '_  4 x Ī  L  J ̫ U '_  X  c '_  , } '_ p   '_ 4 '_ d    8 |   L   ( p   L  ̲   H    H '_  '_     L t    P    0 `  ̷  @  ̸ '_  ` '_  '_  '_  '_  '_  ( '_  X    ĺ   '_ - '_ \  Ȼ  '_ @  '_   > < |   4 | I  4 | I   , t   D  _   8 |   _ H    \    T    T t k    $ h      L    $ H l     4 X |   d    D h    \    P    < `  ~  ( ` '_   $ l   ( d   H   ( p   T   0  '_ x   `    8 |  '_  4  h       $ B R b q       '_  ( l  '_    '_ \    ( p   @    h   H    `    8 x   @    L  '_   L   & '_  d   <   D  D    T   ( p   \ H  c   d i '_  q '_   @ '_   '_  L      @    D    '_ T   '_  T    ` '_   ( l   8 |   '_  D  '_   8    8 |   @    L   ( h       ! 5 H Y  '_  g  `  {  $ h '_  '_    D d    '_   '_ <   '_   P   ( p     P    @     P    d   '_  $ d '_    @    (  l   8 `    `    @ h  !   `   ( T   ( t    X   alias `%s': invalid alias namebind_builtinlvpVPsSf:q:u:m:r:x:%s: cannot read: %s`%s': cannot unbind%s can be invoked via , "%s"%s`%s': unknown function name%s is not bound to any keys. `%s': invalid keymap name_ 7] 7] _ 7] 7] _ 7] 7] 7] 7] 7] 7] 7] 7] 7] 7] 7] 7] 7] 7] 7] ^ 7] 7] 7] 7] 7] ^ ^ 7] 7] ^ ^ ^ ^ 7] ^ ^ 7] Z] only meaningful in a `for', `while', or `until' looploop count%s %s %s NULLOLDPWD=LPwrite error: %schdirCDPATHOLDPWD not setHOME not setpvVcommand_builtin%s: usage: %s: numeric argument required%s: not found%s: invalid option name%s: invalid number%s: %s out of range%s: no such job%s: no job control%s: restricted%s: not a shell builtin`'%s: ambiguous job specSIGJUNK%2d) %sUnknown%s: invalid signal specification`%s': not a pid or valid job spec%s: error retrieving current directory: %s: %s +afiprtxF%s %d %s %s: cannot destroy array variables in this waycannot use `-f' to make functionscan only be used in a functionZ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ʂ ܂ ʂ ʂ ʂ ʂ ^ ʂ ʂ  ʂ ʂ ʂ ʂ ʂ ʂ  ʂ  ʂ  ʂ ʂ ʂ  neEadnpsf:enable -n %s %s: not dynamically loadedenable %s %s: cannot delete: %scannot find %s in shared object %s: %scannot open shared object %s: %sݍ Ό Ό Ս Ό ō Ό Ό Ό Ό Ό Ό Ό  Ό  Ό Ό  %s: file is too large%s: not a regular file_evalfileparse_and_execute_topparse_and_executepe_disposecla:%s: cannot execute: %s~/.bash_logoutThere are stopped jobs. not login shell: use `exit'logout exit :e:lnrs %c%s %sno command foundhistory specificationbash-fc%s: cannot open temp file: %sfc builtin${FCEDIT:-${EDITOR:-vi}} \ \ \ \ \ \  \  \ \ \ ~ r currentjob %d started without job control%4d %s builtin hash -p %s %s hashing disableddlp:rt-t%s %s: hash table empty hits commandF        =    3  ,  # %s: %s %s %s: cannot open: %sShell commands matching keyword `no help topics match `%s'. Try `help help' or `man -k %s' or `info %s'.Shell commands matching keywords `These shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more about the function `name'. Use `info bash' to find out more about the shell in general. Use `man -k' or `info' to find out more about commands not in this list. A star (*) next to a name means that the command is disabled. acd:npsrw%5d%c %s%s %s: history expansion failedhistory positioncannot use more than one of -anrwc  [ M          E  :  2 *    ü lpnxrsjobs_builtinahrno other options allowed with `-x' P  P  P   P P P P e (%ld) - %sUnknown error%s: arguments must be process or job IDsdirectory stack emptydirectory stack index %2d %sno other directorydirstackersa:d:n:p:t:u:read_builtinread error: %d: %s%d: invalid file descriptor: %s%s: invalid file descriptor specification%s: invalid timeout specification[   I :               m  can only `return' from a function or sourced scriptallexportbraceexpanderrexiterrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognotifynounsetonecmdphysicalpipefailprivilegedvixtraceoff%-15s %s set %co %s SHELLOPTSfv%s: not an array variable%s: cannot unset: readonly %s%s: cannot unsetcannot simultaneously unset a function and a variabledeclare -%s %s -%s afnp-ra%s: not a functionshift count%s: file not foundfilename argument requiredcannot suspend a login shellcannot suspendtrap -- %s %s unknowntrap -- %s %d * *   * * * * * * * * * * *  * * * *    %s is hashed (%s) %s is %s alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is aliased to `%s' afptP-type-path-all'                                     core file sizeblocksdata seg sizekbytespending signalsmax locked memorymax memory sizeopen filespipe size512 bytesPOSIX message queuescpu timesecondsmax user processesvirtual memoryfile locks(-%c) %-20s %16sunlimited(%s, -%c) %s: cannot get limit: %s%s: cannot modify limit: %shardsoft`%c': bad commandu=%s,g=%s,o=%s agourwxSp -Sumask%s %04lo octal number`%c': invalid symbolic mode operator`%c': invalid symbolic mode characterOPTARGcdable_varscdspellcheckhashcheckwinsizecmdhistdotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoregnu_errfmthistreedithistappendhistverifyhostcompletehuponexitinteractive_commentslithistlogin_shellmailwarnno_empty_cmd_completionnocaseglobnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathxpg_echo%s: invalid shell option name-sshopt %s %s -upsuoqcannot set and unset shell options simultaneously+ +  + +* + +* B* #'-+ 0warning: %s: %smissing hex digit for \xhjlLtzlldM1 0 0 0 0 M1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 M1 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 41 0 0 0 0 C1 ,2 2 0 2 1 0 0 0 0 0 0 0 F2 0 0 0 92 0 1 0 1 0 U1 9 6 6 6 9 9 9 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 9 :: 69 8 9 9 9 6 8 6 6 6 6 w8 6 6 7 6 7 6 6 6 6 6 `%s': missing format character%s: illegal option -- %c %s: option requires an argument -- %c arrayvarenabledhelptopicgrouprunningservicesetoptsignalstoppeduserbashdefaultdirnamesfilenamesnospaceplusdirs-r%s: invalid action namecomplete -o %s -a-b-d-f-g-j-k-v-A %s -G%s %s -W-P-X-F-Cabcdefgjko:prsuvA:G:W:P:S:X:F:C:%s: no completion specificationwarning: -C option may not work as you expectwarning: -F option may not work as you expectH F G F F G G F F F F F F F F G F F G F F F G G F F F F F F F F G G ~G uG iG ]G QG F F EG 9G F F F F F F F F F F F BASH_REMATCHsocketconnect%s: bad network path specification%ldm%d.%03dssh_makepathsh_realpathTMPDIR/var/tmp/usr/tmp%s/%s-%lushtmpw+         ׄ ׄ                      ׄ ׄ ׄ ӄ ׄ  ׄ ׄ ׄ ׄ ׄ  ׄ               ׄ ׄ  ׄ ׄ                            ׄ ׄ ׄ ׄ  ׄ                           ׄ ׄ ׄ     ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~    z  ~      ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~   ~   ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~     ~  ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~     [ a a a a [ a a a a a a a a         a a a a a a a [ a a a a a  a a a a a a a a a a a a a a a a a a a a a a m a a a a 4 * ɇ a   a a a a a a a  a a a  a  a  a  ‰                                                                                      %s/cur%s/tmp%s/new%s/%s%s/invalid base0123456789ABCDEF0123456789abcdef5.0OAOBOCODOHOF hl^$0ftFT;,%wbeWBE|_*\AaIiCcDdPpYyRrSsXx~(arg: %d) l|h^0bB l|hwW^0bB l|h^0%bBabortaccept-linearrow-key-prefixbackward-bytebackward-charbackward-kill-linebackward-kill-wordbeginning-of-historybeginning-of-linecall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-screencopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charforward-search-historyhistory-search-backwardhistory-search-forwardinsert-commentinsert-completionskill-whole-linekill-regionmenu-completenext-historyoverwrite-modepossible-completionsprevious-historyquoted-insertre-read-init-fileredraw-current-linereverse-search-historyrevert-lineself-insertstart-kbd-macrotab-inserttranspose-charstranspose-wordstty-statusundouniversal-argumentunix-filename-ruboutunix-line-discardunix-word-ruboutupcase-wordyankyank-last-argyank-nth-argyank-popvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-yank-argvi-yank-tonon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-again "\'`@$><=;|&{(--More--Display all %d possibilities? (y or n) readline: bad value %d for what_to_do in rl_complete otherMetaControl-C-CTRL-blink-matching-parenbyte-orientedcompletion-ignore-caseconvert-metadisable-completionenable-keypadexpand-tildehistory-preserve-pointhorizontal-scroll-modeinput-metamark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmeta-flagoutput-metapage-completionsprefer-visible-bellshow-all-if-ambiguousshow-all-if-unmodifiedvisible-statsemacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insertbell-stylecompletion-query-itemsisearch-terminatorskeymapendifincludeDELESCEscapeLFDNewlineRETReturnRuboutSPCSpaceTabC-\M-readline: %s: line %d: %s readline: %s term=mode=$endif without matching $ifnoneaudiblevisible\C-%c"%s": %s %s can be found on ... %s is not bound to any keys # %s (not bound) "%s%s": "%s" %s%s outputs %s set %s %s %s is set to `%s' set bell-style %s set comment-begin %s set editing-mode %s bell-style is set to `%s' comment-begin is set to `%s' editing-mode is set to `%s' set keymap %s keymap is set to `%s' set isearch-terminators "%s" unknown parser directiveno closing `"' in key bindingprefix-meta~/.inputrcINPUTRCprint-completions-horizontally$else found without matching $ifset completion-query-items %d completion-query-items is set to `%d' isearch-terminators is set to "%s"                                                      y              /  >  M    3 Q3 2 2 2 P2 \%oreadline: debug: insert_some_chars: count (%d) != col (%d) sn sn n  n sn sn sn sn sn sn sn sn sn sn  n  n sn sn sn sn  n  n  n /-_=~.#$@7DCclcrdceiimkHkIkdkhklkrkummmopcvbvscoli amkmMTxnX%lu ;&()|<> =unknown expansion errorno previous substitutionevent not foundbad word specifiersubstitution failedunrecognized history modifier() <>;&|$"'`\`"$:$*%^N \ j x  .                                                                            r .     }  ~ ~ G G G G G G G G g  G G G G G G G G G G G G G G G G G G G g  G G G G G G G G G G G G G G G G G G G G G G G G G G  q c                                                            "  NULSOHSTXETXEOTENQACKalertBSbackspaceHTLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELasciiwordalnum?*+@!asciialnumalphablankcntrlgraphlowerpunctupperxdigitNULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzerotwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracket?*+@!'_ n n n n n T n o U o 5w  o x o  p p p p p p p p   p p p p p p p p p p p p p p p p p p p   D  J 7     $     G ]                                 ;(DdzR| PPAB E<AB E\d AB E|PAB E , 7 hq.# p  l,@ooo o@oPoo, Z0`s% :@:3 _$p*p0  wp-`p0pjO@( !`Цp@ ky@g$ Pc@.@b %0ү/h0u0xfgp̳; ųp-P 0_iPi`8 %;` P 6@@ o"@;`9PsP@E p`h`P00Pͯ Ĵpwpɰ$ -0#r P.ҳ۶@6@ڶ` pxp@p!`@g@ # . *@fPp @"@sP) :`p^`p.ª0e0-Ќ A $ 7  7 7 (7 8 mS P `9 4 7  7 , 8 (  8  8  8 P #8 1  B  Q 0 ^8  08  < < < < <  < !< #< $< %< "< &A_ '< (] )< >< <X -` { }< ;h (X )e |e &  tZ < < < < T < <  <  <  =     \V := ? ` { }q  =  9  9  {();&| $  TV V d '_ ] F] ] ] {] ] ] ~] \] ^ "^ " ^ "^ "!^ "-^ "8^ &=^ &G^ &P^ W^ fF0 8 n O^^ Of^ Oo^ "z^ "^ ^ j^ b 1b Gb Xb fb +a8 b4 e0 f, h i k( m n$ p r t u v x B C E H I P T eFn Kn Rn Yn an hn pn xn n n n n n n n n n n n n n n n n o  o o o #o ,o 2o 9o @o Lo Xo ao lo wo o o o o o o o o o o o p  p p $p 0p 

< < : : :  9 9 r8 -8 8 6 B H ## H : Z 4.   8 Y (. @ . \ - @ ] =c  - c m b  - v f5 c -   0d `-   j  -   g ,  v tn  , v  tn ,   {n ,  H6 n ,    `,    X, H  = H,  B  ,    + t  Г  +  # Y#  + + <   *  A ~  * H 4 : * 4 B5 ڨ *  s[  \* Q [ ] L* _ JA   *  7 p ) m x x ) <   `)   / @)  kQ   )   @ (     ( < . L  (  V0   '  < 1  &   M &   * &   p  &   "  l&   "  X&  =  H&  )  @% . h  (% : E H % E Uf V  $ , Sb  $ K i  $ P p  # v   #  < # t Y #  < @#  ? #  T #  tZ " < < "  = "  := "   "   "   "   `"  Q !     !  3   8 vF  ` L c )  D i h4  p U O  x  hS   ; a; B9 [  ; e; E; T; h; Hx H 2 ^ d  ;  < k < m< C< n"< f)< "/< b6< u>< tE< PN<   8   W< pB vb< [  e< xl< S cX? g? dn? |? f]? g? i ? l? |? m? |? n? p? ? q ? ? s? |? t? ? u? v  @ |? x @ 1A "=A EA "OA \A D dA t!lA "uA  A  A A 0 A A ` A  A "A "A "A d A  A  ,  B "B  #- !B  *B "BB MB VB p _B 4 jB  , {B "B ܟ B l< S ?-: aE (\ f5 bH6 c9  d6 @F  eT4 f:= F 0x  F g0 @j< k F (F s0F c 7F >F  FF @ub vKF  OF WF `F jF rF @ O iO P OP Go UP  aP  rP  P . TR  P vu P t j ?k @Hk [k \k \l ]Tl ^l ^l _l `(m {Tm {m |m }n }Xn ~pn o o !o %o )o -o _ 1o 7o  :o  U  Z    =o  @o  Mo  Po  Zo  ]o  mo po so wo {o o o o o o o o o Y o ] o o o o o |n 5w  o !o "o #o $o %o &p 'p (p )1p *:p +Dp ,Jp -Qp -Xp -^p -cp .jp .a / q /tp 0e 1yp 2}p 3p 4p 58 6p 7p 8p 9p :p ;p <p =p >p ?p @p [] \q \q ]*q ^5q ^Gq _Rq `_q {jq {}q |q }q }PX ~Y  ` bash.debuguf?ELF4L 4 (444444  W  HHH Ptd88s 8s ,,Qtd 44HH !hhH-' .t/@#@p7o  Do"S ,,#@\ ll# e,,)`DD) k4q7 w7 x; 8s 8,ds d       S  K |I K K .shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.dynbss.gnu.liblist.gnu.conflict.gnu.prelink_undo 4q4HqH !hqhH-' .to@@P, /.#.p7o  $Do2S ,,3@\ ll3 e,,9`DD9 kDq7 w7 x; 8s 8 ,ds d               S  [   [ `I [ [ Da